{ "10000": { "id": 10000, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": false, "height": false }, "bytes": 0 }, "label": "Mailing List", "type": "contactForm", "content": { "contactFormFields": "Name,Email,Phone,Comments", "contactFormSubject": "Contact Form Submitted", "contactFormExtra": "\n\n\n

Join our mailing list
We will not share or sell your information
Easily unsubscribe any time


", "contactFormNotificationEmail": "" }, "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "0000-00-00 00:00:00", "filters": [ "Pages" ], "key": "10000" }, "10001": { "id": 10001, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": false, "height": false }, "bytes": 0 }, "label": "Buy Prints", "type": "link", "content": "http://jimgoldenstudio.bigcartel.com/", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Pages" ] }, "10002": { "id": 10002, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": false, "height": false }, "bytes": 0 }, "label": "[facebook]", "type": "link", "content": "http://www.facebook.com/pages/Jim-Golden-Studio/362593507085149?ref=tn_tnmn", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Pages" ] }, "10003": { "id": 10003, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": false, "height": false }, "bytes": 0 }, "label": "[twitter]", "type": "link", "content": "http://twitter.com/#!/jimgolden", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Pages" ] }, "10004": { "id": 10004, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": false, "height": false }, "bytes": 0 }, "label": "[linkedin]", "type": "link", "content": "http://www.linkedin.com/in/jimgoldenstudio", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [ "Pages" ] }, "10005": { "id": 10005, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Contact Info", "type": "html", "content": "Jim Golden Studio / District Collective\n1825 NE 43rd Ave Portland, Oregon 97213\n\nGOOGLE MAP\n\nDeb Ayerst, Artist Agent: 415-567-3570, deb@debayerst.com\n\nJim, Photographer: 503-819-7217, jim@jimgoldenstudio.com\n", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2017-02-17T03:04:32.835Z", "filters": [ "Pages" ] }, "10006": { "id": 10006, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0, "pageImages": [] }, "label": "Contact", "type": "html", "content": "

Jim Golden

503-819-7217

jim@jimgoldenstudio.com


Mailing Address:

Jim Golden Studio

3519 NE 15th Ave #482

Portland, Oregon 97212







", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2017-01-31T22:06:59.246Z", "filters": [ "Pages" ], "key": "10006" }, "10007": { "id": 10007, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": false, "height": false }, "bytes": 0 }, "label": "Blog", "type": "link", "content": "http://jimgolden.tumblr.com/", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Pages" ] }, "10008": { "id": 10008, "size": { "content": { "width": false, "height": false }, "thumb": { "width": false, "height": false }, "featuredImage": { "width": 1710, "height": 1140 }, "bytes": 0 }, "label": "About the Studio", "type": "html", "content": "Centrally located in Portland's popular Williams Corridor, Jim Golden Studio is a complete digital photography studio dedicated to creativity, mindfulness to detail and customer service. With a seasoned staff of lighting techs, digital techs and stylists, JGS takes projects from concept to post-production in one seamless process.\r\n\r\nCompelling photography is just one step in achieving clients’ visual goals. The JGS team works to anticipate potential production issues and keeps your project rolling smoothly and within budget.\r\n\r\nStudio facilities include: a 1500-square-foot shooting area, fully equipped digital studio, stocked kitchen, Wi-Fi, convenient free parking, and wheelchair access.\r\n\r\nClients are invited to be involved in the studio, oversee from the comfort of the lounge or spread out in the glass-wall conference room, in view of the shooting space.\r\n\r\nSome past and present clients include: ESPN the Magazine, Field & Stream Magazine, Kinfolk Magazine, Money Magazine, Sunset Magazine, adidas, Giro, Keen, Nike, Salomon, Yahoo!, Coates Kokes, McKinney, and more.\r\n", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "Jim_Golden_Studio_Bikes-copy1.jpg", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Pages" ], "oldFeaturedImage": "Jim_Golden_Studio_Bikes-copy1.jpg" }, "10009": { "id": 10009, "size": { "content": { "width": false, "height": false }, "thumb": { "width": 1500, "height": 1500 }, "featuredImage": { "width": 300, "height": 300 }, "bytes": 0, "pageImages": [] }, "label": "About Jim", "type": "html", "content": "

An award-winning photographer and director specializing in still life and products, Jim brings an artist's eye and an enthusiast's passion to his work. He strives to capture the pared-down essence of his subjects, rather than impose a false sense of beauty upon them. The viewer is invited to enjoy an often-inanimate object for its stark simplicity or quiet quality. Jim is a consummate professional with 20+ years of industry experience. His easy-going attitude and sense of humor ensure that clients not only receive top-quality work, but also enjoy the process.


Clients include: Harley-Davidson, Salt & Straw, Nama Juicers , Apple, Nike, Jockey, The Clorox Companies, adidas, Simpson Strong-Tie, Ann Sacks Tile, Hoka One One, Ahnu, Haworth, Soy Vay, New Seasons Market, Reebok, Weight Watchers, Sodexo, Sherwin Williams, Jordan, Keen Footwear. Agencies include: Wieden&Kennedy, McKinney, Kayser&Co., AKQA, TBWA, Kamp Grizzly, North, J.Schmidt.


Jim's collections are featured in Austin Radcliffe's book Things Organized Neatly published by Universe/Rizzoli in 2016, the definitive volume for this direct and timeless style of photography. Jim's Barrette Collection image is showcased on the cover.


WINNER - 2023 Communications Arts Photo Annual


Interviews & Articles:

Schoolhouse Electric - Making of the Beachcomber Print Q&A

Pictureline: Relics of Technology: A Look Back with Jim Golden

Big Cartel - Jim Golden Finds Beauty in the Process

A Photo Editor - The Art of the Personal Project: Jim Golden

WIRED – This Guy Turns OCD Hoarding Into Amazing Photos

WIRED – Charming Photos of Iconic Tech Relics, From Brick Phones to Zip Drives

Fast Company – Beautifully Pristine Relics of Technology Past


Follow Jim on Instagram:

@jimgolden

@jim.golden.studio


ALL CONTENT © 2026 Jim Golden ALL RIGHTS RESERVED



















", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "xjim-golden-self-portrait.jpg", "dateAdded": "2017-01-31T22:02:50.513Z", "filters": [ "Pages" ], "key": "10009" }, "10010": { "id": 10010, "size": { "content": { "width": 860, "height": 1140 }, "thumb": { "width": 860, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 67914 }, "label": "Camping Gear Vignette.jpg", "type": "image", "content": "CampingGearVignette.jpg", "thumb": "CampingGearVignette.jpg", "linkTarget": "", "caption": "Camping Gear Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Camping Gear Vignette.jpg", "oldThumb": "Camping Gear Vignette.jpg" }, "10011": { "id": 10011, "size": { "content": { "width": 400, "height": 266 }, "thumb": { "width": 400, "height": 266 }, "featuredImage": { "width": false, "height": false }, "bytes": 91731 }, "label": "Portland_Commercial_Photography_Studio.jpg", "type": "image", "content": "20110810-4114-BLDG-25_400.jpg", "thumb": "20110810-4114-BLDG-25_400.jpg", "linkTarget": "", "caption": "Portland Commercial Photography Studio", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "20110810-4114-BLDG-25_400.jpg", "oldThumb": "20110810-4114-BLDG-25_400.jpg" }, "10012": { "id": 10012, "size": { "content": { "width": 905, "height": 1140 }, "thumb": { "width": 905, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 66930 }, "label": "Camping Gear Vignette 3.jpg", "type": "image", "content": "CampingGearVignette3.jpg", "thumb": "CampingGearVignette3.jpg", "linkTarget": "", "caption": "Camping Gear Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Camping Gear Vignette 3.jpg", "oldThumb": "Camping Gear Vignette 3.jpg" }, "10013": { "id": 10013, "size": { "content": { "width": 905, "height": 1140 }, "thumb": { "width": 905, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 60855 }, "label": "Camping Gear Vignette 2.jpg", "type": "image", "content": "CampingGearVignette2.jpg", "thumb": "CampingGearVignette2.jpg", "linkTarget": "", "caption": "Camping Gear Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Camping Gear Vignette 2.jpg", "oldThumb": "Camping Gear Vignette 2.jpg" }, "10014": { "id": 10014, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 33118 }, "label": "Vintage Video Camera Still Life.jpg", "type": "image", "content": "VintageVideoCameraStillLife.jpg", "thumb": "VintageVideoCameraStillLife.jpg", "linkTarget": "", "caption": "Vintage Video Camera Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Video Camera Still Life.jpg", "oldThumb": "Vintage Video Camera Still Life.jpg" }, "10015": { "id": 10015, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 35375 }, "label": "Fishing Rod Still Life.jpg", "type": "image", "content": "FishingRodStillLife.jpg", "thumb": "FishingRodStillLife.jpg", "linkTarget": "", "caption": "Fishing Rod Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Fishing Rod Still Life.jpg", "oldThumb": "Fishing Rod Still Life.jpg" }, "10016": { "id": 10016, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 49683 }, "label": "Vintage Lantern Still Life.jpg", "type": "image", "content": "VintageLanternStillLife.jpg", "thumb": "VintageLanternStillLife.jpg", "linkTarget": "", "caption": "Vintage Lantern Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Lantern Still Life.jpg", "oldThumb": "Vintage Lantern Still Life.jpg" }, "10017": { "id": 10017, "size": { "content": { "width": 1823, "height": 1140 }, "thumb": { "width": 1823, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 231117 }, "label": "Danner Boots Still Life.jpg", "type": "image", "content": "DannerBootsStillLife.jpg", "thumb": "DannerBootsStillLife.jpg", "linkTarget": "", "caption": "Danner Boots Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Danner Boots Still Life.jpg", "oldThumb": "Danner Boots Still Life.jpg" }, "10018": { "id": 10018, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 28924 }, "label": "Vintage Flashlight Still Life.jpg", "type": "image", "content": "VintageFlashlightStillLife.jpg", "thumb": "VintageFlashlightStillLife.jpg", "linkTarget": "", "caption": "Vintage Flash Light Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Flashlight Still Life.jpg", "oldThumb": "Vintage Flashlight Still Life.jpg" }, "10019": { "id": 10019, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 84118 }, "label": "Vintage Fishing Net Still Life.jpg", "type": "image", "content": "VintageFishingNetStillLife.jpg", "thumb": "VintageFishingNetStillLife.jpg", "linkTarget": "", "caption": "Vintage Fishing Net Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Fishing Net Still Life.jpg", "oldThumb": "Vintage Fishing Net Still Life.jpg" }, "10020": { "id": 10020, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 48609 }, "label": "Vintage Canteen Still Life.jpg", "type": "image", "content": "VintageCanteenStillLife.jpg", "thumb": "VintageCanteenStillLife.jpg", "linkTarget": "", "caption": "Vintage Canteen Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Canteen Still Life.jpg", "oldThumb": "Vintage Canteen Still Life.jpg" }, "10021": { "id": 10021, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 24656 }, "label": "Vintage Axe Still Life.jpg", "type": "image", "content": "VintageAxeStillLife.jpg", "thumb": "VintageAxeStillLife.jpg", "linkTarget": "", "caption": "Vintage Axe Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Axe Still Life.jpg", "oldThumb": "Vintage Axe Still Life.jpg" }, "10022": { "id": 10022, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 918, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 46829 }, "label": "Nikon Camera Still Life.jpg", "type": "image", "content": "NikonCameraStillLife.jpg", "thumb": "NikonCameraStillLife.jpg", "linkTarget": "", "caption": "Nikon Camera Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Nikon Camera Still Life.jpg", "oldThumb": "Nikon Camera Still Life.jpg" }, "10023": { "id": 10023, "size": { "content": { "width": 1423, "height": 1140 }, "thumb": { "width": 1423, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 195064 }, "label": "Instruments_Laydown.jpg", "type": "image", "content": "Instruments_Laydown.jpg", "thumb": "Instruments_Laydown.jpg", "linkTarget": "", "caption": "Instruments Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Instruments_Laydown.jpg", "oldThumb": "Instruments_Laydown.jpg" }, "10024": { "id": 10024, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 29580 }, "label": "Big Wheel Still Life.jpg", "type": "image", "content": "BigWheelStillLife.jpg", "thumb": "BigWheelStillLife.jpg", "linkTarget": "", "caption": "Murdered Out Big Wheel Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Big Wheel Still Life.jpg", "oldThumb": "Big Wheel Still Life.jpg" }, "10025": { "id": 10025, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 60728 }, "label": "Black House.jpg", "type": "image", "content": "BlackHouse.jpg", "thumb": "BlackHouse.jpg", "linkTarget": "", "caption": "Murdered Out House Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Black House.jpg", "oldThumb": "Black House.jpg", "postDate": "2019-02-05T00:03:27.380Z" }, "10026": { "id": 10026, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 44331 }, "label": "Camera Still Life.jpg", "type": "image", "content": "CameraStillLife.jpg", "thumb": "CameraStillLife.jpg", "linkTarget": "", "caption": "Camera Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Camera Still Life.jpg", "oldThumb": "Camera Still Life.jpg" }, "10027": { "id": 10027, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 53970 }, "label": "Chainsaw Still Life.jpg", "type": "image", "content": "ChainsawStillLife.jpg", "thumb": "ChainsawStillLife.jpg", "linkTarget": "", "caption": "Chainsaw Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Chainsaw Still Life.jpg", "oldThumb": "Chainsaw Still Life.jpg" }, "10028": { "id": 10028, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 25368 }, "label": "Radio Flyer Still Life.jpg", "type": "image", "content": "RadioFlyerStillLife.jpg", "thumb": "RadioFlyerStillLife.jpg", "linkTarget": "", "caption": "Murdered out Radio Flyer Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Radio Flyer Still Life.jpg", "oldThumb": "Radio Flyer Still Life.jpg" }, "10029": { "id": 10029, "size": { "content": { "width": 1584, "height": 1140 }, "thumb": { "width": 1584, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 27768 }, "label": "Rifle Still Life 2.jpg", "type": "image", "content": "RifleStillLife2.jpg", "thumb": "RifleStillLife2.jpg", "linkTarget": "", "caption": "Rifle Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Rifle Still Life 2.jpg", "oldThumb": "Rifle Still Life 2.jpg" }, "10030": { "id": 10030, "size": { "content": { "width": 1547, "height": 1140 }, "thumb": { "width": 1547, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 88101 }, "label": "Rifle Still Life.jpg", "type": "image", "content": "RifleStillLife.jpg", "thumb": "RifleStillLife.jpg", "linkTarget": "", "caption": "J. Stevens A & T Co. Rifle Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Dark Still Life" ], "oldFilename": "Rifle Still Life.jpg", "oldThumb": "Rifle Still Life.jpg" }, "10031": { "id": 10031, "size": { "content": { "width": 1471, "height": 1140 }, "thumb": { "width": 1471, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 59720 }, "label": "Saw Still Life.jpg", "type": "image", "content": "SawStillLife.jpg", "thumb": "SawStillLife.jpg", "linkTarget": "", "caption": "Saw Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Saw Still Life.jpg", "oldThumb": "Saw Still Life.jpg" }, "10032": { "id": 10032, "size": { "content": { "width": 843, "height": 1140 }, "thumb": { "width": 843, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 23824 }, "label": "Scissors Still Life 2.jpg", "type": "image", "content": "ScissorsStillLife2.jpg", "thumb": "ScissorsStillLife2.jpg", "linkTarget": "", "caption": "Scissors Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Scissors Still Life 2.jpg", "oldThumb": "Scissors Still Life 2.jpg" }, "10033": { "id": 10033, "size": { "content": { "width": 843, "height": 1140 }, "thumb": { "width": 843, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 20105 }, "label": "Scissors Still Life 3.jpg", "type": "image", "content": "ScissorsStillLife3.jpg", "thumb": "ScissorsStillLife3.jpg", "linkTarget": "", "caption": "Scissors Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Still Life" ], "oldFilename": "Scissors Still Life 3.jpg", "oldThumb": "Scissors Still Life 3.jpg" }, "10034": { "id": 10034, "size": { "content": { "width": 841, "height": 1140 }, "thumb": { "width": 841, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 21469 }, "label": "Scissors Still Life 4.jpg", "type": "image", "content": "ScissorsStillLife4.jpg", "thumb": "ScissorsStillLife4.jpg", "linkTarget": "", "caption": "Scissors Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Scissors Still Life 4.jpg", "oldThumb": "Scissors Still Life 4.jpg" }, "10035": { "id": 10035, "size": { "content": { "width": 1686, "height": 1140 }, "thumb": { "width": 1686, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 84192 }, "label": "Scissors Still Life.jpg", "type": "image", "content": "ScissorsStillLife.jpg", "thumb": "ScissorsStillLife.jpg", "linkTarget": "", "caption": "Scissors Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Scissors Still Life.jpg", "oldThumb": "Scissors Still Life.jpg" }, "10036": { "id": 10036, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 44306 }, "label": "Shopping Cart Still Life.jpg", "type": "image", "content": "ShoppingCartStillLife.jpg", "thumb": "ShoppingCartStillLife.jpg", "linkTarget": "", "caption": "Murdered Out Shopping Cart Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Shopping Cart Still Life.jpg", "oldThumb": "Shopping Cart Still Life.jpg" }, "10037": { "id": 10037, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 20038 }, "label": "Snow Sled Still Life.jpg", "type": "image", "content": "SnowSledStillLife.jpg", "thumb": "SnowSledStillLife.jpg", "linkTarget": "", "caption": "Murdered Out Snow Sled Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Snow Sled Still Life.jpg", "oldThumb": "Snow Sled Still Life.jpg" }, "10038": { "id": 10038, "size": { "content": { "width": 1471, "height": 1140 }, "thumb": { "width": 1471, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 79716 }, "label": "Turntable Still Life.jpg", "type": "image", "content": "TurntableStillLife.jpg", "thumb": "TurntableStillLife.jpg", "linkTarget": "", "caption": "Turntable Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Turntable Still Life.jpg", "oldThumb": "Turntable Still Life.jpg" }, "10039": { "id": 10039, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 44499 }, "label": "Vintage Stereo Still Life 2.jpg", "type": "image", "content": "VintageStereoStillLife2.jpg", "thumb": "VintageStereoStillLife2.jpg", "linkTarget": "", "caption": "Vintage Stereo Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Stereo Still Life 2.jpg", "oldThumb": "Vintage Stereo Still Life 2.jpg" }, "10040": { "id": 10040, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 108070 }, "label": "Vintage Stereo Still Life.jpg", "type": "image", "content": "VintageStereoStillLife.jpg", "thumb": "VintageStereoStillLife.jpg", "linkTarget": "", "caption": "Vintage Stereo Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Stereo Still Life.jpg", "oldThumb": "Vintage Stereo Still Life.jpg" }, "10041": { "id": 10041, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 20632 }, "label": "Walker Still Life.jpg", "type": "image", "content": "WalkerStillLife.jpg", "thumb": "WalkerStillLife.jpg", "linkTarget": "", "caption": "Murdered Out Walker Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Walker Still Life.jpg", "oldThumb": "Walker Still Life.jpg" }, "10042": { "id": 10042, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 29767 }, "label": "Wheelbarrow Still Life.jpg", "type": "image", "content": "WheelbarrowStillLife.jpg", "thumb": "WheelbarrowStillLife.jpg", "linkTarget": "", "caption": "Murdered Out Wheelbarrow Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Wheelbarrow Still Life.jpg", "oldThumb": "Wheelbarrow Still Life.jpg" }, "10043": { "id": 10043, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 98288 }, "label": "Arborist Portrait 2.jpg", "type": "image", "content": "ArboristPortrait2.jpg", "thumb": "ArboristPortrait2.jpg", "linkTarget": "", "caption": "Arborist Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Arborist Portrait 2.jpg", "oldThumb": "Arborist Portrait 2.jpg" }, "10044": { "id": 10044, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 56945 }, "label": "Arborist Portrait.jpg", "type": "image", "content": "ArboristPortrait.jpg", "thumb": "ArboristPortrait.jpg", "linkTarget": "", "caption": "Arborist Light Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Arborist Portrait.jpg", "oldThumb": "Arborist Portrait.jpg" }, "10045": { "id": 10045, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 68853 }, "label": "Beer Brewer Portrait 2.jpg", "type": "image", "content": "BeerBrewerPortrait2.jpg", "thumb": "BeerBrewerPortrait2.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Beer Brewer Portrait 2.jpg", "oldThumb": "Beer Brewer Portrait 2.jpg" }, "10046": { "id": 10046, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 43574 }, "label": "Beer Brewer Portrait 3.jpg", "type": "image", "content": "BeerBrewerPortrait3.jpg", "thumb": "BeerBrewerPortrait3.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Beer Brewer Portrait 3.jpg", "oldThumb": "Beer Brewer Portrait 3.jpg" }, "10047": { "id": 10047, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 95181 }, "label": "Beer Brewer Portrait 4.jpg", "type": "image", "content": "BeerBrewerPortrait4.jpg", "thumb": "BeerBrewerPortrait4.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Beer Brewer Portrait 4.jpg", "oldThumb": "Beer Brewer Portrait 4.jpg" }, "10048": { "id": 10048, "size": { "content": { "width": 913, "height": 1140 }, "thumb": { "width": 913, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 43745 }, "label": "Beer Brewer Portrait 5.jpg", "type": "image", "content": "BeerBrewerPortrait5.jpg", "thumb": "BeerBrewerPortrait5.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Beer Brewer Portrait 5.jpg", "oldThumb": "Beer Brewer Portrait 5.jpg" }, "10049": { "id": 10049, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 49568 }, "label": "Beer Brewer Portrait.jpg", "type": "image", "content": "BeerBrewerPortrait.jpg", "thumb": "BeerBrewerPortrait.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Beer Brewer Portrait.jpg", "oldThumb": "Beer Brewer Portrait.jpg" }, "10050": { "id": 10050, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 47013 }, "label": "Bicycle Mechanic Portrait.jpg", "type": "image", "content": "BicycleMechanicPortrait.jpg", "thumb": "BicycleMechanicPortrait.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Bicycle Mechanic Portrait.jpg", "oldThumb": "Bicycle Mechanic Portrait.jpg" }, "10051": { "id": 10051, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 54719 }, "label": "Bike Mechanic Portrait.jpg", "type": "image", "content": "BikeMechanicPortrait.jpg", "thumb": "BikeMechanicPortrait.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Bike Mechanic Portrait.jpg", "oldThumb": "Bike Mechanic Portrait.jpg" }, "10052": { "id": 10052, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 53362 }, "label": "Firefighter Portrait 2.jpg", "type": "image", "content": "FirefighterPortrait2.jpg", "thumb": "FirefighterPortrait2.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Firefighter Portrait 2.jpg", "oldThumb": "Firefighter Portrait 2.jpg" }, "10053": { "id": 10053, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 94909 }, "label": "Firefighter Portrait 3.jpg", "type": "image", "content": "FirefighterPortrait3.jpg", "thumb": "FirefighterPortrait3.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Firefighter Portrait 3.jpg", "oldThumb": "Firefighter Portrait 3.jpg" }, "10054": { "id": 10054, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 65272 }, "label": "Firefighter Portrait.jpg", "type": "image", "content": "FirefighterPortrait.jpg", "thumb": "FirefighterPortrait.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Firefighter Portrait.jpg", "oldThumb": "Firefighter Portrait.jpg" }, "10055": { "id": 10055, "size": { "content": { "width": 921, "height": 1140 }, "thumb": { "width": 921, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 68280 }, "label": "Portland Firefighter Portrait.jpg", "type": "image", "content": "PortlandFirefighterPortrait.jpg", "thumb": "PortlandFirefighterPortrait.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Portland Firefighter Portrait.jpg", "oldThumb": "Portland Firefighter Portrait.jpg" }, "10056": { "id": 10056, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 46800 }, "label": "Tree Trimmer Portrait.jpg", "type": "image", "content": "TreeTrimmerPortrait.jpg", "thumb": "TreeTrimmerPortrait.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:30", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Tree Trimmer Portrait.jpg", "oldThumb": "Tree Trimmer Portrait.jpg" }, "10057": { "id": 10057, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 72878 }, "label": "American Athlete Portrait 1.jpg", "type": "image", "content": "AmericanAthletePortrait1.jpg", "thumb": "AmericanAthletePortrait1.jpg", "linkTarget": "", "caption": "American Athlete Dark Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "American Athlete Portrait 1.jpg", "oldThumb": "American Athlete Portrait 1.jpg" }, "10058": { "id": 10058, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 47203 }, "label": "American Athlete Portrait 2.jpg", "type": "image", "content": "AmericanAthletePortrait2.jpg", "thumb": "AmericanAthletePortrait2.jpg", "linkTarget": "", "caption": "American Athlete Dark Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "American Athlete Portrait 2.jpg", "oldThumb": "American Athlete Portrait 2.jpg" }, "10059": { "id": 10059, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 49640 }, "label": "American Athlete Portrait 3.jpg", "type": "image", "content": "AmericanAthletePortrait3.jpg", "thumb": "AmericanAthletePortrait3.jpg", "linkTarget": "", "caption": "American Athlete Dark Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "American Athlete Portrait 3.jpg", "oldThumb": "American Athlete Portrait 3.jpg" }, "10060": { "id": 10060, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 72940 }, "label": "American Athlete Portrait 4.jpg", "type": "image", "content": "AmericanAthletePortrait4.jpg", "thumb": "AmericanAthletePortrait4.jpg", "linkTarget": "", "caption": "American Athlete Dark Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "American Athlete Portrait 4.jpg", "oldThumb": "American Athlete Portrait 4.jpg" }, "10061": { "id": 10061, "size": { "content": { "width": 1050, "height": 1400 }, "thumb": { "width": 1050, "height": 1400 }, "featuredImage": { "width": false, "height": false }, "bytes": 159337 }, "label": "Downhill Mountain Biker Portrait.jpg", "type": "image", "content": "DownhillMountainBikerPortrait.jpg", "thumb": "DownhillMountainBikerPortrait.jpg", "linkTarget": "", "caption": "Downhill Mountain Biker Dark Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Downhill Mountain Biker Portrait.jpg", "oldThumb": "Downhill Mountain Biker Portrait.jpg" }, "10062": { "id": 10062, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 77735 }, "label": "Woman Mountain Biker Portrait.jpg", "type": "image", "content": "WomanMountainBikerPortrait.jpg", "thumb": "WomanMountainBikerPortrait.jpg", "linkTarget": "", "caption": "Woman Mountain Biker Dark Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Woman Mountain Biker Portrait.jpg", "oldThumb": "Woman Mountain Biker Portrait.jpg" }, "10063": { "id": 10063, "size": { "content": { "width": 1823, "height": 1140 }, "thumb": { "width": 1823, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 184228 }, "label": "Product Still Life.jpg", "type": "image", "content": "ProductStillLife.jpg", "thumb": "ProductStillLife.jpg", "linkTarget": "", "caption": "Vintage Camping Gear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Product Still Life.jpg", "oldThumb": "Product Still Life.jpg" }, "10064": { "id": 10064, "size": { "content": { "width": 1836, "height": 1140 }, "thumb": { "width": 1836, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 142198 }, "label": "Vintage Camping Gear Still Life.jpg", "type": "image", "content": "VintageCampingGearStillLife.jpg", "thumb": "VintageCampingGearStillLife.jpg", "linkTarget": "", "caption": "Vintage Camping Gear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Vintage Camping Gear Still Life.jpg", "oldThumb": "Vintage Camping Gear Still Life.jpg" }, "10065": { "id": 10065, "size": { "content": { "width": 1778, "height": 1140 }, "thumb": { "width": 1778, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 275877 }, "label": "Camping Gear Still Life.jpg", "type": "image", "content": "CampingGearStillLife.jpg", "thumb": "CampingGearStillLife.jpg", "linkTarget": "", "caption": "Camping Gear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:30.000Z", "filters": [], "oldFilename": "Camping Gear Still Life.jpg", "oldThumb": "Camping Gear Still Life.jpg" }, "10066": { "id": 10066, "size": { "content": { "width": 1836, "height": 1140 }, "thumb": { "width": 1836, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 169069 }, "label": "Vintage Camping Lights Still Life.jpg", "type": "image", "content": "VintageCampingLightsStillLife.jpg", "thumb": "VintageCampingLightsStillLife.jpg", "linkTarget": "", "caption": "Vintage Camping Gear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Vintage Camping Lights Still Life.jpg", "oldThumb": "Vintage Camping Lights Still Life.jpg" }, "10067": { "id": 10067, "size": { "content": { "width": 1836, "height": 1140 }, "thumb": { "width": 1836, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 154391 }, "label": "Vintage Fishing Gear Still Life.jpg", "type": "image", "content": "VintageFishingGearStillLife.jpg", "thumb": "VintageFishingGearStillLife.jpg", "linkTarget": "", "caption": "Vintage Fishing Gear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Vintage Fishing Gear Still Life.jpg", "oldThumb": "Vintage Fishing Gear Still Life.jpg" }, "10068": { "id": 10068, "size": { "content": { "width": 1833, "height": 1140 }, "thumb": { "width": 1833, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 285666 }, "label": "Firefighter Light Portraits.jpg", "type": "image", "content": "FirefighterLightPortraits.jpg", "thumb": "FirefighterLightPortraits.jpg", "linkTarget": "", "caption": "Portland Firefighters", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Firefighter Light Portraits.jpg", "oldThumb": "Firefighter Light Portraits.jpg" }, "10069": { "id": 10069, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 282173 }, "label": "Beer Brewer Light Portraits.jpg", "type": "image", "content": "BeerBrewerLightPortraits.jpg", "thumb": "BeerBrewerLightPortraits.jpg", "linkTarget": "", "caption": "Beer Brewer Light Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Beer Brewer Light Portraits.jpg", "oldThumb": "Beer Brewer Light Portraits.jpg" }, "10070": { "id": 10070, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 181563 }, "label": "Bicycle Mechanic Portraits.jpg", "type": "image", "content": "BicycleMechanicPortraits.jpg", "thumb": "BicycleMechanicPortraits.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Bicycle Mechanic Portraits.jpg", "oldThumb": "Bicycle Mechanic Portraits.jpg" }, "10071": { "id": 10071, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 210656 }, "label": "Firefighter Portraits.jpg", "type": "image", "content": "FirefighterPortraits.jpg", "thumb": "FirefighterPortraits.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Firefighter Portraits.jpg", "oldThumb": "Firefighter Portraits.jpg" }, "10072": { "id": 10072, "size": { "content": { "width": 1825, "height": 1140 }, "thumb": { "width": 1825, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 163662 }, "label": "Light Portraits.jpg", "type": "image", "content": "LightPortraits.jpg", "thumb": "LightPortraits.jpg", "linkTarget": "", "caption": "Portraits on White", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Light Portraits.jpg", "oldThumb": "Light Portraits.jpg" }, "10073": { "id": 10073, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 252357 }, "label": "Tree Trimmer Portraits.jpg", "type": "image", "content": "TreeTrimmerPortraits.jpg", "thumb": "TreeTrimmerPortraits.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Tree Trimmer Portraits.jpg", "oldThumb": "Tree Trimmer Portraits.jpg" }, "10074": { "id": 10074, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 167470 }, "label": "Beer Brewer Portraits.jpg", "type": "image", "content": "BeerBrewerPortraits.jpg", "thumb": "BeerBrewerPortraits.jpg", "linkTarget": "", "caption": "Beer Brewer Light Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Beer Brewer Portraits.jpg", "oldThumb": "Beer Brewer Portraits.jpg" }, "10075": { "id": 10075, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 111328 }, "label": "Housewares_Still_Life.jpg", "type": "image", "content": "Housewares_Still_Life.jpg", "thumb": "Housewares_Still_Life.jpg", "linkTarget": "", "caption": "Graphic Housewares Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Housewares_Still_Life.jpg", "oldThumb": "Housewares_Still_Life.jpg" }, "10076": { "id": 10076, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 235477 }, "label": "Coastal_Photography_1.jpg", "type": "image", "content": "Coastal_Photography_1.jpg", "thumb": "Coastal_Photography_1.jpg", "linkTarget": "", "caption": "Coastal Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coastal_Photography_1.jpg", "oldThumb": "Coastal_Photography_1.jpg" }, "10077": { "id": 10077, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 238520 }, "label": "Coastal_Photography_2.jpg", "type": "image", "content": "Coastal_Photography_2.jpg", "thumb": "Coastal_Photography_2.jpg", "linkTarget": "", "caption": "Coastal Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coastal_Photography_2.jpg", "oldThumb": "Coastal_Photography_2.jpg" }, "10078": { "id": 10078, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 227306 }, "label": "Coastal_Photography_3.jpg", "type": "image", "content": "Coastal_Photography_3.jpg", "thumb": "Coastal_Photography_3.jpg", "linkTarget": "", "caption": "Coastal Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coastal_Photography_3.jpg", "oldThumb": "Coastal_Photography_3.jpg" }, "10079": { "id": 10079, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 192689 }, "label": "Coastal_Photography_4.jpg", "type": "image", "content": "Coastal_Photography_4.jpg", "thumb": "Coastal_Photography_4.jpg", "linkTarget": "", "caption": "Coastal Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coastal_Photography_4.jpg", "oldThumb": "Coastal_Photography_4.jpg" }, "10080": { "id": 10080, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 166220 }, "label": "Coastal_Photography_5.jpg", "type": "image", "content": "Coastal_Photography_5.jpg", "thumb": "Coastal_Photography_5.jpg", "linkTarget": "", "caption": "Coastal Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coastal_Photography_5.jpg", "oldThumb": "Coastal_Photography_5.jpg" }, "10081": { "id": 10081, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 183412 }, "label": "Oregon_Coast_1.jpg", "type": "image", "content": "Oregon_Coast_1.jpg", "thumb": "Oregon_Coast_1.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_1.jpg", "oldThumb": "Oregon_Coast_1.jpg" }, "10082": { "id": 10082, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 226587 }, "label": "Oregon_Coast_2.jpg", "type": "image", "content": "Oregon_Coast_2.jpg", "thumb": "Oregon_Coast_2.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_2.jpg", "oldThumb": "Oregon_Coast_2.jpg" }, "10083": { "id": 10083, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 118081 }, "label": "Oregon_Coast_3.jpg", "type": "image", "content": "Oregon_Coast_3.jpg", "thumb": "Oregon_Coast_3.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_3.jpg", "oldThumb": "Oregon_Coast_3.jpg" }, "10084": { "id": 10084, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 189969 }, "label": "Oregon_Coast_4.jpg", "type": "image", "content": "Oregon_Coast_4.jpg", "thumb": "Oregon_Coast_4.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_4.jpg", "oldThumb": "Oregon_Coast_4.jpg" }, "10085": { "id": 10085, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 208932 }, "label": "Oregon_Coast_5.jpg", "type": "image", "content": "Oregon_Coast_5.jpg", "thumb": "Oregon_Coast_5.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_5.jpg", "oldThumb": "Oregon_Coast_5.jpg" }, "10086": { "id": 10086, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 90769 }, "label": "Oregon_Coast_6.jpg", "type": "image", "content": "Oregon_Coast_6.jpg", "thumb": "Oregon_Coast_6.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_6.jpg", "oldThumb": "Oregon_Coast_6.jpg" }, "10087": { "id": 10087, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 135727 }, "label": "Oregon_Coast_7.jpg", "type": "image", "content": "Oregon_Coast_7.jpg", "thumb": "Oregon_Coast_7.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_7.jpg", "oldThumb": "Oregon_Coast_7.jpg" }, "10088": { "id": 10088, "size": { "content": { "width": 1140, "height": 907 }, "thumb": { "width": 1140, "height": 907 }, "featuredImage": { "width": false, "height": false }, "bytes": 100827 }, "label": "Oregon_Coast_8.jpg", "type": "image", "content": "Oregon_Coast_8.jpg", "thumb": "Oregon_Coast_8.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_8.jpg", "oldThumb": "Oregon_Coast_8.jpg" }, "10089": { "id": 10089, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 149781 }, "label": "Oregon_Coast_9.jpg", "type": "image", "content": "Oregon_Coast_9.jpg", "thumb": "Oregon_Coast_9.jpg", "linkTarget": "", "caption": "Oregon Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_9.jpg", "oldThumb": "Oregon_Coast_9.jpg" }, "10090": { "id": 10090, "size": { "content": { "width": 1140, "height": 848 }, "thumb": { "width": 1140, "height": 848 }, "featuredImage": { "width": false, "height": false }, "bytes": 82754 }, "label": "Oregon_Coast_Photograp_2.jpg", "type": "image", "content": "Oregon_Coast_Photograp_2.jpg", "thumb": "Oregon_Coast_Photograp_2.jpg", "linkTarget": "", "caption": "Oregon Coast Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_Photograp_2.jpg", "oldThumb": "Oregon_Coast_Photograp_2.jpg" }, "10091": { "id": 10091, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 144819 }, "label": "Oregon_Coast_Photograph_1.jpg", "type": "image", "content": "Oregon_Coast_Photograph_1.jpg", "thumb": "Oregon_Coast_Photograph_1.jpg", "linkTarget": "", "caption": "Oregon Coast Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_Photograph_1.jpg", "oldThumb": "Oregon_Coast_Photograph_1.jpg" }, "10092": { "id": 10092, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 213256 }, "label": "Oregon_Coast_Photograph_3.jpg", "type": "image", "content": "Oregon_Coast_Photograph_3.jpg", "thumb": "Oregon_Coast_Photograph_3.jpg", "linkTarget": "", "caption": "Oregon Coast Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_Photograph_3.jpg", "oldThumb": "Oregon_Coast_Photograph_3.jpg" }, "10093": { "id": 10093, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 206204 }, "label": "Oregon_Coast_Photograph_4.jpg", "type": "image", "content": "Oregon_Coast_Photograph_4.jpg", "thumb": "Oregon_Coast_Photograph_4.jpg", "linkTarget": "", "caption": "Oregon Coast Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_Photograph_4.jpg", "oldThumb": "Oregon_Coast_Photograph_4.jpg" }, "10094": { "id": 10094, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 1710, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 266779 }, "label": "Oregon_Coast_Photograph_5.jpg", "type": "image", "content": "Oregon_Coast_Photograph_5.jpg", "thumb": "Oregon_Coast_Photograph_5.jpg", "linkTarget": "", "caption": "Oregon Coast Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_Photograph_5.jpg", "oldThumb": "Oregon_Coast_Photograph_5.jpg" }, "10095": { "id": 10095, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 132119 }, "label": "Oregon_Coast_Photograph_6.jpg", "type": "image", "content": "Oregon_Coast_Photograph_6.jpg", "thumb": "Oregon_Coast_Photograph_6.jpg", "linkTarget": "", "caption": "Oregon Coast Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Oregon_Coast_Photograph_6.jpg", "oldThumb": "Oregon_Coast_Photograph_6.jpg" }, "10096": { "id": 10096, "size": { "content": { "width": 1389, "height": 1140 }, "thumb": { "width": 1389, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 252641 }, "label": "Camera_Laydown.jpg", "type": "image", "content": "Camera_Laydown.jpg", "thumb": "Camera_Laydown.jpg", "linkTarget": "", "caption": "Camera Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Camera_Laydown.jpg", "oldThumb": "Camera_Laydown.jpg" }, "10097": { "id": 10097, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 1529, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 281238 }, "label": "Scissor_Collection.jpg", "type": "image", "content": "Scissor_Collection.jpg", "thumb": "Scissor_Collection.jpg", "linkTarget": "", "caption": "Scissor Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Scissor_Collection.jpg", "oldThumb": "Scissor_Collection.jpg" }, "10098": { "id": 10098, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 1710, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 334276 }, "label": "Videotapes_Layflat.jpg", "type": "image", "content": "Videotapes_Layflat.jpg", "thumb": "Videotapes_Layflat.jpg", "linkTarget": "", "caption": "Videotapes Layflat", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Videotapes_Layflat.jpg", "oldThumb": "Videotapes_Layflat.jpg" }, "10099": { "id": 10099, "size": { "content": { "width": 1684, "height": 1140 }, "thumb": { "width": 1684, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 84054 }, "label": "Scissor Still Life.jpg", "type": "image", "content": "ScissorStillLife.jpg", "thumb": "ScissorStillLife.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Scissor Still Life.jpg", "oldThumb": "Scissor Still Life.jpg" }, "10100": { "id": 10100, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 1710, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 120012 }, "label": "Murdered Out Still Life.jpg", "type": "image", "content": "MurderedOutStillLife.jpg", "thumb": "MurderedOutStillLife.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Murdered Out Still Life.jpg", "oldThumb": "Murdered Out Still Life.jpg" }, "10101": { "id": 10101, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 122059 }, "label": "Bald_Man_Portrait.jpg", "type": "image", "content": "Bald_Man_Portrait.jpg", "thumb": "Bald_Man_Portrait.jpg", "linkTarget": "", "caption": "Bald Man Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Bald_Man_Portrait.jpg", "oldThumb": "Bald_Man_Portrait.jpg" }, "10102": { "id": 10102, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 142466 }, "label": "Bearded_Man_Portrait.jpg", "type": "image", "content": "Bearded_Man_Portrait.jpg", "thumb": "Bearded_Man_Portrait.jpg", "linkTarget": "", "caption": "Bearded Man Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Bearded_Man_Portrait.jpg", "oldThumb": "Bearded_Man_Portrait.jpg" }, "10103": { "id": 10103, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 100681 }, "label": "Bearded_Man.jpg", "type": "image", "content": "Bearded_Man.jpg", "thumb": "Bearded_Man.jpg", "linkTarget": "", "caption": "Bearded Man", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Bearded_Man.jpg", "oldThumb": "Bearded_Man.jpg" }, "10104": { "id": 10104, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 90162 }, "label": "Dark_Portrait_of_a_Man.jpg", "type": "image", "content": "Dark_Portrait_of_a_Man.jpg", "thumb": "Dark_Portrait_of_a_Man.jpg", "linkTarget": "", "caption": "Dark Portrait of a Man", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Dark_Portrait_of_a_Man.jpg", "oldThumb": "Dark_Portrait_of_a_Man.jpg" }, "10105": { "id": 10105, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 79807 }, "label": "Portrait_of_Man_with_Beard.jpg", "type": "image", "content": "Portrait_of_Man_with_Beard.jpg", "thumb": "Portrait_of_Man_with_Beard.jpg", "linkTarget": "", "caption": "Portrait of Man with Beard", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Portrait_of_Man_with_Beard.jpg", "oldThumb": "Portrait_of_Man_with_Beard.jpg" }, "10106": { "id": 10106, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 118804 }, "label": "Real_Man_Portrait.jpg", "type": "image", "content": "Real_Man_Portrait.jpg", "thumb": "Real_Man_Portrait.jpg", "linkTarget": "", "caption": "Real Man Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Real_Man_Portrait.jpg", "oldThumb": "Real_Man_Portrait.jpg" }, "10107": { "id": 10107, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 83795 }, "label": "Bearded_Male_Portrait.jpg", "type": "image", "content": "Bearded_Male_Portrait.jpg", "thumb": "Bearded_Male_Portrait.jpg", "linkTarget": "", "caption": "Bearded Male Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Bearded_Male_Portrait.jpg", "oldThumb": "Bearded_Male_Portrait.jpg" }, "10108": { "id": 10108, "size": { "content": { "width": 1424, "height": 1140 }, "thumb": { "width": 1424, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 314842 }, "label": "8Track_Collection.jpg", "type": "image", "content": "8Track_Collection.jpg", "thumb": "8Track_Collection.jpg", "linkTarget": "", "caption": "8Track Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "8Track_Collection.jpg", "oldThumb": "8Track_Collection.jpg" }, "10109": { "id": 10109, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 303571 }, "label": "Cassette_Tape_Layflat.jpg", "type": "image", "content": "Cassette_Tape_Layflat.jpg", "thumb": "Cassette_Tape_Layflat.jpg", "linkTarget": "", "caption": "Cassette Tape Layflat", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Cassette_Tape_Layflat.jpg", "oldThumb": "Cassette_Tape_Layflat.jpg" }, "10110": { "id": 10110, "size": { "content": { "width": 1397, "height": 1140 }, "thumb": { "width": 1397, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 192202 }, "label": "Colorful_Housewares_Collection.jpg", "type": "image", "content": "Colorful_Housewares_Collection.jpg", "thumb": "Colorful_Housewares_Collection.jpg", "linkTarget": "", "caption": "Colorful Housewares Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Colorful_Housewares_Collection.jpg", "oldThumb": "Colorful_Housewares_Collection.jpg" }, "10111": { "id": 10111, "size": { "content": { "width": 1800, "height": 1440 }, "thumb": { "width": 1800, "height": 1440 }, "featuredImage": { "width": false, "height": false }, "bytes": 258042 }, "label": "Vintage_Hunting_Firearms.jpg", "type": "image", "content": "Vintage_Hunting_Firearms.jpg", "thumb": "Vintage_Hunting_Firearms.jpg", "linkTarget": "", "caption": "Vintage Hunting Firearms", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Vintage_Hunting_Firearms.jpg", "oldThumb": "Vintage_Hunting_Firearms.jpg" }, "10112": { "id": 10112, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 120627 }, "label": "Fire_Chief_Portrait.jpg", "type": "image", "content": "Fire_Chief_Portrait.jpg", "thumb": "Fire_Chief_Portrait.jpg", "linkTarget": "", "caption": "Fire Chief Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Fire_Chief_Portrait.jpg", "oldThumb": "Fire_Chief_Portrait.jpg" }, "10113": { "id": 10113, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 126728 }, "label": "Firefighter_Light_Portrait 4.jpg", "type": "image", "content": "Firefighter_Light_Portrait4.jpg", "thumb": "Firefighter_Light_Portrait4.jpg", "linkTarget": "", "caption": "Firefighter Light Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Firefighter_Light_Portrait 4.jpg", "oldThumb": "Firefighter_Light_Portrait 4.jpg" }, "10114": { "id": 10114, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 1762, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 67992 }, "label": "Light_Tradeswomen_Portrait.jpg", "type": "image", "content": "Light_Tradeswomen_Portrait.jpg", "thumb": "Light_Tradeswomen_Portrait.jpg", "linkTarget": "", "caption": "Light Tradeswomen Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Light_Tradeswomen_Portrait.jpg", "oldThumb": "Light_Tradeswomen_Portrait.jpg" }, "10115": { "id": 10115, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 83456 }, "label": "superhero mom holding baby son", "type": "image", "content": "Mother_Light_Portrait.jpg", "thumb": "Mother_Light_Portrait.jpg", "linkTarget": "", "caption": "Mother Light Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.643Z", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Mother_Light_Portrait.jpg", "oldThumb": "Mother_Light_Portrait.jpg", "key": "10115" }, "10116": { "id": 10116, "size": { "content": { "width": 1140, "height": 814 }, "thumb": { "width": 1140, "height": 814 }, "featuredImage": { "width": false, "height": false }, "bytes": 51313 }, "label": "woman skier with skis over her shoulder", "type": "image", "content": "Woman_Skier_Portrait.jpg", "thumb": "Woman_Skier_Portrait.jpg", "linkTarget": "", "caption": "Woman Skier Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Light Portraits - New SEO Done" ], "oldFilename": "Woman_Skier_Portrait.jpg", "oldThumb": "Woman_Skier_Portrait.jpg", "key": "10116" }, "10117": { "id": 10117, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 182156 }, "label": "Things_Organized_Neatly.jpg", "type": "image", "content": "Things_Organized_Neatly.jpg", "thumb": "Things_Organized_Neatly.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Things_Organized_Neatly.jpg", "oldThumb": "Things_Organized_Neatly.jpg" }, "10118": { "id": 10118, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 37671 }, "label": "Dark_Footwear_Still_Life.jpg", "type": "image", "content": "Dark_Footwear_Still_Life.jpg", "thumb": "Dark_Footwear_Still_Life.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Dark Still Life" ], "oldFilename": "Dark_Footwear_Still_Life.jpg", "oldThumb": "Dark_Footwear_Still_Life.jpg" }, "10119": { "id": 10119, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 35179 }, "label": "Footwear_Dark_Still_Life.jpg", "type": "image", "content": "Footwear_Dark_Still_Life.jpg", "thumb": "Footwear_Dark_Still_Life.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Dark Still Life" ], "oldFilename": "Footwear_Dark_Still_Life.jpg", "oldThumb": "Footwear_Dark_Still_Life.jpg" }, "10120": { "id": 10120, "size": { "content": { "width": 1628, "height": 1140 }, "thumb": { "width": 1628, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 121573 }, "label": "Dark Footwear Still Life.jpg", "type": "image", "content": "DarkFootwearStillLife.jpg", "thumb": "DarkFootwearStillLife.jpg", "linkTarget": "", "caption": "Dark Footwear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:31.000Z", "filters": [], "oldFilename": "Dark Footwear Still Life.jpg", "oldThumb": "Dark Footwear Still Life.jpg" }, "10121": { "id": 10121, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 166680 }, "label": "Coast_Landscape_Photography_2.jpg", "type": "image", "content": "Coast_Landscape_Photography_2.jpg", "thumb": "Coast_Landscape_Photography_2.jpg", "linkTarget": "", "caption": "Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coast_Landscape_Photography_2.jpg", "oldThumb": "Coast_Landscape_Photography_2.jpg" }, "10122": { "id": 10122, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 1140, "height": 912 }, "featuredImage": { "width": false, "height": false }, "bytes": 180405 }, "label": "Coast_Landscape_Photography_3.jpg", "type": "image", "content": "Coast_Landscape_Photography_3.jpg", "thumb": "Coast_Landscape_Photography_3.jpg", "linkTarget": "", "caption": "Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coast_Landscape_Photography_3.jpg", "oldThumb": "Coast_Landscape_Photography_3.jpg" }, "10123": { "id": 10123, "size": { "content": { "width": 1140, "height": 907 }, "thumb": { "width": 1140, "height": 907 }, "featuredImage": { "width": false, "height": false }, "bytes": 87382 }, "label": "Coast_Landscape_Photography.jpg", "type": "image", "content": "Coast_Landscape_Photography.jpg", "thumb": "Coast_Landscape_Photography.jpg", "linkTarget": "", "caption": "Coast Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Coastal" ], "oldFilename": "Coast_Landscape_Photography.jpg", "oldThumb": "Coast_Landscape_Photography.jpg" }, "10124": { "id": 10124, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 260593 }, "label": "People_Portraits.jpg", "type": "image", "content": "People_Portraits.jpg", "thumb": "People_Portraits.jpg", "linkTarget": "", "caption": "People Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Archive - New for SEO" ], "oldFilename": "People_Portraits.jpg", "oldThumb": "People_Portraits.jpg" }, "10125": { "id": 10125, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 1480, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 131662 }, "label": "Real_People_Portraits_2.jpg", "type": "image", "content": "Real_People_Portraits_2.jpg", "thumb": "Real_People_Portraits_2.jpg", "linkTarget": "", "caption": "Real People Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Real_People_Portraits_2.jpg", "oldThumb": "Real_People_Portraits_2.jpg" }, "10126": { "id": 10126, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 1480, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 167387 }, "label": "Real_People_Portraits_3.jpg", "type": "image", "content": "Real_People_Portraits_3.jpg", "thumb": "Real_People_Portraits_3.jpg", "linkTarget": "", "caption": "Real People Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Real_People_Portraits_3.jpg", "oldThumb": "Real_People_Portraits_3.jpg" }, "10127": { "id": 10127, "size": { "content": { "width": 1483, "height": 1140 }, "thumb": { "width": 1483, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 168668 }, "label": "Real_People_Portraits.jpg", "type": "image", "content": "Real_People_Portraits.jpg", "thumb": "Real_People_Portraits.jpg", "linkTarget": "", "caption": "Real People Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Real_People_Portraits.jpg", "oldThumb": "Real_People_Portraits.jpg" }, "10128": { "id": 10128, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 1480, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 146457 }, "label": "Small_Town_People_Portraits.jpg", "type": "image", "content": "Small_Town_People_Portraits.jpg", "thumb": "Small_Town_People_Portraits.jpg", "linkTarget": "", "caption": "Small Town People Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Small_Town_People_Portraits.jpg", "oldThumb": "Small_Town_People_Portraits.jpg" }, "10129": { "id": 10129, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 1480, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 192533 }, "label": "Small_Town_Portraits.jpg", "type": "image", "content": "Small_Town_Portraits.jpg", "thumb": "Small_Town_Portraits.jpg", "linkTarget": "", "caption": "Small Town Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Small_Town_Portraits.jpg", "oldThumb": "Small_Town_Portraits.jpg" }, "10130": { "id": 10130, "size": { "content": { "width": 1483, "height": 1140 }, "thumb": { "width": 1483, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 175694 }, "label": "Small_Town_Real-People.jpg", "type": "image", "content": "Small_Town_Real-People.jpg", "thumb": "Small_Town_Real-People.jpg", "linkTarget": "", "caption": "Small Town Real People", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Small_Town_Real-People.jpg", "oldThumb": "Small_Town_Real-People.jpg" }, "10131": { "id": 10131, "size": { "content": { "width": 1917, "height": 1400 }, "thumb": { "width": 1917, "height": 1400 }, "featuredImage": { "width": false, "height": false }, "bytes": 238543 }, "label": "Tulelake_2.jpg", "type": "image", "content": "Tulelake_2.jpg", "thumb": "Tulelake_2.jpg", "linkTarget": "", "caption": "Tulelake", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake_2.jpg", "oldThumb": "Tulelake_2.jpg" }, "10132": { "id": 10132, "size": { "content": { "width": 1561, "height": 1140 }, "thumb": { "width": 1561, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 153126 }, "label": "Tulelake_CA.jpg", "type": "image", "content": "Tulelake_CA.jpg", "thumb": "Tulelake_CA.jpg", "linkTarget": "", "caption": "Tulelake, CA", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake_CA.jpg", "oldThumb": "Tulelake_CA.jpg" }, "10133": { "id": 10133, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 1480, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 188756 }, "label": "Tulelake_California_2.jpg", "type": "image", "content": "Tulelake_California_2.jpg", "thumb": "Tulelake_California_2.jpg", "linkTarget": "", "caption": "Tulelake, California", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake_California_2.jpg", "oldThumb": "Tulelake_California_2.jpg" }, "10134": { "id": 10134, "size": { "content": { "width": 1482, "height": 1140 }, "thumb": { "width": 1482, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 330423 }, "label": "Tulelake_California_Project.jpg", "type": "image", "content": "Tulelake_California_Project.jpg", "thumb": "Tulelake_California_Project.jpg", "linkTarget": "", "caption": "Tulelake, California Project", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake_California_Project.jpg", "oldThumb": "Tulelake_California_Project.jpg" }, "10135": { "id": 10135, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 1480, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 176368 }, "label": "Tulelake_California.jpg", "type": "image", "content": "Tulelake_California.jpg", "thumb": "Tulelake_California.jpg", "linkTarget": "", "caption": "Tulelake, California", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake_California.jpg", "oldThumb": "Tulelake_California.jpg", "key": "10135" }, "10136": { "id": 10136, "size": { "content": { "width": 1561, "height": 1140 }, "thumb": { "width": 1561, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 109242 }, "label": "Tulelake_Landscape.jpg", "type": "image", "content": "Tulelake_Landscape.jpg", "thumb": "Tulelake_Landscape.jpg", "linkTarget": "", "caption": "Tulelake Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake_Landscape.jpg", "oldThumb": "Tulelake_Landscape.jpg" }, "10137": { "id": 10137, "size": { "content": { "width": 1561, "height": 1140 }, "thumb": { "width": 1561, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 169252 }, "label": "Tulelake.jpg", "type": "image", "content": "Tulelake.jpg", "thumb": "Tulelake.jpg", "linkTarget": "", "caption": "Tulelake", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Tulelake" ], "oldFilename": "Tulelake.jpg", "oldThumb": "Tulelake.jpg" }, "10138": { "id": 10138, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 273253 }, "label": "Hawaii_Building.jpg", "type": "image", "content": "Hawaii_Building.jpg", "thumb": "Hawaii_Building.jpg", "linkTarget": "", "caption": "Hawaii Building", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Hawaii_Building.jpg", "oldThumb": "Hawaii_Building.jpg" }, "10139": { "id": 10139, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 267408 }, "label": "Hawaii_Culture.jpg", "type": "image", "content": "Hawaii_Culture.jpg", "thumb": "Hawaii_Culture.jpg", "linkTarget": "", "caption": "Hawaii Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Hawaii_Culture.jpg", "oldThumb": "Hawaii_Culture.jpg" }, "10140": { "id": 10140, "size": { "content": { "width": 843, "height": 1140 }, "thumb": { "width": 843, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 97441 }, "label": "Hawaii_Street_Squalor.jpg", "type": "image", "content": "Hawaii_Street_Squalor.jpg", "thumb": "Hawaii_Street_Squalor.jpg", "linkTarget": "", "caption": "Hawaii Street Squalor", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Hawaii_Street_Squalor.jpg", "oldThumb": "Hawaii_Street_Squalor.jpg" }, "10141": { "id": 10141, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 126991 }, "label": "Honolullu_Culture.jpg", "type": "image", "content": "Honolullu_Culture.jpg", "thumb": "Honolullu_Culture.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolullu_Culture.jpg", "oldThumb": "Honolullu_Culture.jpg" }, "10142": { "id": 10142, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 127782 }, "label": "Honolulu_Apartment_Architecture.jpg", "type": "image", "content": "Honolulu_Apartment_Architecture.jpg", "thumb": "Honolulu_Apartment_Architecture.jpg", "linkTarget": "", "caption": "Honolulu Apartment Architecture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Apartment_Architecture.jpg", "oldThumb": "Honolulu_Apartment_Architecture.jpg" }, "10143": { "id": 10143, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 110787 }, "label": "Honolulu_Architecture.jpg", "type": "image", "content": "Honolulu_Architecture.jpg", "thumb": "Honolulu_Architecture.jpg", "linkTarget": "", "caption": "Honolulu Architecture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Architecture.jpg", "oldThumb": "Honolulu_Architecture.jpg" }, "10144": { "id": 10144, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 242757 }, "label": "Honolulu_Buildings.jpg", "type": "image", "content": "Honolulu_Buildings.jpg", "thumb": "Honolulu_Buildings.jpg", "linkTarget": "", "caption": "Honolulu Buildings", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Buildings.jpg", "oldThumb": "Honolulu_Buildings.jpg" }, "10145": { "id": 10145, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 132376 }, "label": "Honolulu_Hawaii_Squalor.jpg", "type": "image", "content": "Honolulu_Hawaii_Squalor.jpg", "thumb": "Honolulu_Hawaii_Squalor.jpg", "linkTarget": "", "caption": "Honolulu Hawaii Squalor", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Hawaii_Squalor.jpg", "oldThumb": "Honolulu_Hawaii_Squalor.jpg" }, "10146": { "id": 10146, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 296281 }, "label": "Honolulu_Motel.jpg", "type": "image", "content": "Honolulu_Motel.jpg", "thumb": "Honolulu_Motel.jpg", "linkTarget": "", "caption": "Honolulu Motel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Motel.jpg", "oldThumb": "Honolulu_Motel.jpg" }, "10147": { "id": 10147, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 183155 }, "label": "Honolulu_Neighborhood.jpg", "type": "image", "content": "Honolulu_Neighborhood.jpg", "thumb": "Honolulu_Neighborhood.jpg", "linkTarget": "", "caption": "Honolulu Neighborhood", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Neighborhood.jpg", "oldThumb": "Honolulu_Neighborhood.jpg" }, "10148": { "id": 10148, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 126978 }, "label": "Honolulu_Poor_Neighborhood.jpg", "type": "image", "content": "Honolulu_Poor_Neighborhood.jpg", "thumb": "Honolulu_Poor_Neighborhood.jpg", "linkTarget": "", "caption": "Honolulu Poor Neighborhood", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Poor_Neighborhood.jpg", "oldThumb": "Honolulu_Poor_Neighborhood.jpg" }, "10149": { "id": 10149, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 222020 }, "label": "Honolulu_Squalor.jpg", "type": "image", "content": "Honolulu_Squalor.jpg", "thumb": "Honolulu_Squalor.jpg", "linkTarget": "", "caption": "Honolulu Squalor", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Squalor.jpg", "oldThumb": "Honolulu_Squalor.jpg" }, "10150": { "id": 10150, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 195064 }, "label": "Honolulu_Street.jpg", "type": "image", "content": "Honolulu_Street.jpg", "thumb": "Honolulu_Street.jpg", "linkTarget": "", "caption": "Honolulu Street", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Street.jpg", "oldThumb": "Honolulu_Street.jpg" }, "10151": { "id": 10151, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 112070 }, "label": "Honolulu_Trash.jpg", "type": "image", "content": "Honolulu_Trash.jpg", "thumb": "Honolulu_Trash.jpg", "linkTarget": "", "caption": "Honolulu Trash", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Trash.jpg", "oldThumb": "Honolulu_Trash.jpg" }, "10152": { "id": 10152, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 161460 }, "label": "Honolulu.jpg", "type": "image", "content": "Honolulu.jpg", "thumb": "Honolulu.jpg", "linkTarget": "", "caption": "Honolulu", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:31", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu.jpg", "oldThumb": "Honolulu.jpg" }, "10153": { "id": 10153, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 156475 }, "label": "Island_Landscape.jpg", "type": "image", "content": "Island_Landscape.jpg", "thumb": "Island_Landscape.jpg", "linkTarget": "", "caption": "Island Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Island_Landscape.jpg", "oldThumb": "Island_Landscape.jpg" }, "10154": { "id": 10154, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 197615 }, "label": "Tropical_Cityscape.jpg", "type": "image", "content": "Tropical_Cityscape.jpg", "thumb": "Tropical_Cityscape.jpg", "linkTarget": "", "caption": "Tropical Cityscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Tropical_Cityscape.jpg", "oldThumb": "Tropical_Cityscape.jpg" }, "10155": { "id": 10155, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 126076 }, "label": "Tropical_Landscape.jpg", "type": "image", "content": "Tropical_Landscape.jpg", "thumb": "Tropical_Landscape.jpg", "linkTarget": "", "caption": "Tropical Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Tropical_Landscape.jpg", "oldThumb": "Tropical_Landscape.jpg", "key": "10155" }, "10156": { "id": 10156, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 433317 }, "label": "Hololulu Apartment Architecture.jpg", "type": "image", "content": "HololuluApartmentArchitecture.jpg", "thumb": "HololuluApartmentArchitecture.jpg", "linkTarget": "", "caption": "Honolulu Apartment Architecture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Hololulu Apartment Architecture.jpg", "oldThumb": "Hololulu Apartment Architecture.jpg" }, "10157": { "id": 10157, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 434611 }, "label": "Hololulu Culture.jpg", "type": "image", "content": "HololuluCulture.jpg", "thumb": "HololuluCulture.jpg", "linkTarget": "", "caption": "Honolulu Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Hololulu Culture.jpg", "oldThumb": "Hololulu Culture.jpg" }, "10158": { "id": 10158, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 496138 }, "label": "Honolulu Neighborhood.jpg", "type": "image", "content": "HonoluluNeighborhood.jpg", "thumb": "HonoluluNeighborhood.jpg", "linkTarget": "", "caption": "Honolulu Neighborhood", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu Neighborhood.jpg", "oldThumb": "Honolulu Neighborhood.jpg" }, "10159": { "id": 10159, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 208566 }, "label": "Honolulu_Landscape.jpg", "type": "image", "content": "Honolulu_Landscape.jpg", "thumb": "Honolulu_Landscape.jpg", "linkTarget": "", "caption": "Honolulu Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Lost in Paradise" ], "oldFilename": "Honolulu_Landscape.jpg", "oldThumb": "Honolulu_Landscape.jpg" }, "10160": { "id": 10160, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 231197 }, "label": "Fishtown_Buildings.jpg", "type": "image", "content": "Fishtown_Buildings.jpg", "thumb": "Fishtown_Buildings.jpg", "linkTarget": "", "caption": "Fishtown Buildings", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Fishtown_Buildings.jpg", "oldThumb": "Fishtown_Buildings.jpg", "key": "10160" }, "10161": { "id": 10161, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 191233 }, "label": "PA_Buildings.jpg", "type": "image", "content": "PA_Buildings.jpg", "thumb": "PA_Buildings.jpg", "linkTarget": "", "caption": "PA Buildings", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "PA_Buildings.jpg", "oldThumb": "PA_Buildings.jpg" }, "10162": { "id": 10162, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 245775 }, "label": "PA_Street_Photography.jpg", "type": "image", "content": "PA_Street_Photography.jpg", "thumb": "PA_Street_Photography.jpg", "linkTarget": "", "caption": "PA Street Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "PA_Street_Photography.jpg", "oldThumb": "PA_Street_Photography.jpg" }, "10163": { "id": 10163, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 224456 }, "label": "Pensylvania_Squalor.jpg", "type": "image", "content": "Pensylvania_Squalor.jpg", "thumb": "Pensylvania_Squalor.jpg", "linkTarget": "", "caption": "Pennsylvania Squalor", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Pensylvania_Squalor.jpg", "oldThumb": "Pensylvania_Squalor.jpg" }, "10164": { "id": 10164, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 179635 }, "label": "Philadelphia_Architecture.jpg", "type": "image", "content": "Philadelphia_Architecture.jpg", "thumb": "Philadelphia_Architecture.jpg", "linkTarget": "", "caption": "Philadelphia Architecture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Architecture.jpg", "oldThumb": "Philadelphia_Architecture.jpg" }, "10165": { "id": 10165, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 195065 }, "label": "Philadelphia_Buildings.jpg", "type": "image", "content": "Philadelphia_Buildings.jpg", "thumb": "Philadelphia_Buildings.jpg", "linkTarget": "", "caption": "Philadelphia Buildings", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Buildings.jpg", "oldThumb": "Philadelphia_Buildings.jpg" }, "10166": { "id": 10166, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 227202 }, "label": "Philadelphia_Cityscape.jpg", "type": "image", "content": "Philadelphia_Cityscape.jpg", "thumb": "Philadelphia_Cityscape.jpg", "linkTarget": "", "caption": "Philadelphia Cityscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Cityscape.jpg", "oldThumb": "Philadelphia_Cityscape.jpg" }, "10167": { "id": 10167, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 232517 }, "label": "Philadelphia_Homes.jpg", "type": "image", "content": "Philadelphia_Homes.jpg", "thumb": "Philadelphia_Homes.jpg", "linkTarget": "", "caption": "Philadelphia Homes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Homes.jpg", "oldThumb": "Philadelphia_Homes.jpg" }, "10168": { "id": 10168, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 193891 }, "label": "Philadelphia_Neighborhood.jpg", "type": "image", "content": "Philadelphia_Neighborhood.jpg", "thumb": "Philadelphia_Neighborhood.jpg", "linkTarget": "", "caption": "Philadelphia Neighborhood", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Neighborhood.jpg", "oldThumb": "Philadelphia_Neighborhood.jpg" }, "10169": { "id": 10169, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 194413 }, "label": "Philadelphia_Squalor.jpg", "type": "image", "content": "Philadelphia_Squalor.jpg", "thumb": "Philadelphia_Squalor.jpg", "linkTarget": "", "caption": "Philadelphia Squalor", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Squalor.jpg", "oldThumb": "Philadelphia_Squalor.jpg" }, "10170": { "id": 10170, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 218494 }, "label": "Philadelphia_Street_Photography.jpg", "type": "image", "content": "Philadelphia_Street_Photography.jpg", "thumb": "Philadelphia_Street_Photography.jpg", "linkTarget": "", "caption": "Philadelphia Street Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Street_Photography.jpg", "oldThumb": "Philadelphia_Street_Photography.jpg" }, "10171": { "id": 10171, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 245715 }, "label": "Philadelphia_Streets.jpg", "type": "image", "content": "Philadelphia_Streets.jpg", "thumb": "Philadelphia_Streets.jpg", "linkTarget": "", "caption": "Philadelphia Streets", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia_Streets.jpg", "oldThumb": "Philadelphia_Streets.jpg" }, "10172": { "id": 10172, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 201622 }, "label": "Philadelphia.jpg", "type": "image", "content": "Philadelphia.jpg", "thumb": "Philadelphia.jpg", "linkTarget": "", "caption": "Philadelphia", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia.jpg", "oldThumb": "Philadelphia.jpg" }, "10173": { "id": 10173, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 199696 }, "label": "Philadephia Building.jpg", "type": "image", "content": "PhiladephiaBuilding.jpg", "thumb": "PhiladephiaBuilding.jpg", "linkTarget": "", "caption": "Philadelphia Building", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadephia Building.jpg", "oldThumb": "Philadephia Building.jpg" }, "10174": { "id": 10174, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 233888 }, "label": "Philadephia_Houses.jpg", "type": "image", "content": "Philadephia_Houses.jpg", "thumb": "Philadephia_Houses.jpg", "linkTarget": "", "caption": "Philadelphia Houses", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadephia_Houses.jpg", "oldThumb": "Philadephia_Houses.jpg" }, "10175": { "id": 10175, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 216849 }, "label": "Philly_Architecture.jpg", "type": "image", "content": "Philly_Architecture.jpg", "thumb": "Philly_Architecture.jpg", "linkTarget": "", "caption": "Philly Architecture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Architecture.jpg", "oldThumb": "Philly_Architecture.jpg" }, "10176": { "id": 10176, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 226742 }, "label": "Philly_Buildings.jpg", "type": "image", "content": "Philly_Buildings.jpg", "thumb": "Philly_Buildings.jpg", "linkTarget": "", "caption": "Philly Buildings", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Buildings.jpg", "oldThumb": "Philly_Buildings.jpg" }, "10177": { "id": 10177, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 214702 }, "label": "Philly_Cityscape.jpg", "type": "image", "content": "Philly_Cityscape.jpg", "thumb": "Philly_Cityscape.jpg", "linkTarget": "", "caption": "Philly Cityscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Cityscape.jpg", "oldThumb": "Philly_Cityscape.jpg" }, "10178": { "id": 10178, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 245774 }, "label": "Philly_Culture.jpg", "type": "image", "content": "Philly_Culture.jpg", "thumb": "Philly_Culture.jpg", "linkTarget": "", "caption": "Philly Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Culture.jpg", "oldThumb": "Philly_Culture.jpg" }, "10179": { "id": 10179, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 228658 }, "label": "Philly_Home.jpg", "type": "image", "content": "Philly_Home.jpg", "thumb": "Philly_Home.jpg", "linkTarget": "", "caption": "Philly Home", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Home.jpg", "oldThumb": "Philly_Home.jpg" }, "10180": { "id": 10180, "size": { "content": { "width": 1140, "height": 1425 }, "thumb": { "width": 1140, "height": 1425 }, "featuredImage": { "width": false, "height": false }, "bytes": 203552 }, "label": "Philly_Homes.jpg", "type": "image", "content": "Philly_Homes.jpg", "thumb": "Philly_Homes.jpg", "linkTarget": "", "caption": "Philly Homes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Homes.jpg", "oldThumb": "Philly_Homes.jpg" }, "10181": { "id": 10181, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 230087 }, "label": "Philly_Hood.jpg", "type": "image", "content": "Philly_Hood.jpg", "thumb": "Philly_Hood.jpg", "linkTarget": "", "caption": "Philly Hood", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Hood.jpg", "oldThumb": "Philly_Hood.jpg" }, "10182": { "id": 10182, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 226202 }, "label": "Philly_Houses.jpg", "type": "image", "content": "Philly_Houses.jpg", "thumb": "Philly_Houses.jpg", "linkTarget": "", "caption": "Philly Houses", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Houses.jpg", "oldThumb": "Philly_Houses.jpg" }, "10183": { "id": 10183, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 188445 }, "label": "Philly_Neighborhood.jpg", "type": "image", "content": "Philly_Neighborhood.jpg", "thumb": "Philly_Neighborhood.jpg", "linkTarget": "", "caption": "Philly Neighborhood", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Neighborhood.jpg", "oldThumb": "Philly_Neighborhood.jpg" }, "10184": { "id": 10184, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 223933 }, "label": "Philly_Small_Business.jpg", "type": "image", "content": "Philly_Small_Business.jpg", "thumb": "Philly_Small_Business.jpg", "linkTarget": "", "caption": "Philly Small Business", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Small_Business.jpg", "oldThumb": "Philly_Small_Business.jpg" }, "10185": { "id": 10185, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 912, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 205958 }, "label": "Philly_Squalor.jpg", "type": "image", "content": "Philly_Squalor.jpg", "thumb": "Philly_Squalor.jpg", "linkTarget": "", "caption": "Philly Squalor", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Squalor.jpg", "oldThumb": "Philly_Squalor.jpg" }, "10186": { "id": 10186, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 199874 }, "label": "Philly_Street_Photography.jpg", "type": "image", "content": "Philly_Street_Photography.jpg", "thumb": "Philly_Street_Photography.jpg", "linkTarget": "", "caption": "Philly Street Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Street_Photography.jpg", "oldThumb": "Philly_Street_Photography.jpg" }, "10187": { "id": 10187, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 203593 }, "label": "Philly_Streets.jpg", "type": "image", "content": "Philly_Streets.jpg", "thumb": "Philly_Streets.jpg", "linkTarget": "", "caption": "Philly Streets", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Streets.jpg", "oldThumb": "Philly_Streets.jpg" }, "10188": { "id": 10188, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 206961 }, "label": "Philly.jpg", "type": "image", "content": "Philly.jpg", "thumb": "Philly.jpg", "linkTarget": "", "caption": "Philly", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly.jpg", "oldThumb": "Philly.jpg" }, "10189": { "id": 10189, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 226311 }, "label": "Poor_Philly.jpg", "type": "image", "content": "Poor_Philly.jpg", "thumb": "Poor_Philly.jpg", "linkTarget": "", "caption": "Poor Philly ", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Poor_Philly.jpg", "oldThumb": "Poor_Philly.jpg" }, "10190": { "id": 10190, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 198063 }, "label": "Squalor_of_Philadelphia.jpg", "type": "image", "content": "Squalor_of_Philadelphia.jpg", "thumb": "Squalor_of_Philadelphia.jpg", "linkTarget": "", "caption": "Squalor of Philadelphia", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Squalor_of_Philadelphia.jpg", "oldThumb": "Squalor_of_Philadelphia.jpg" }, "10191": { "id": 10191, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 201159 }, "label": "Squalor_of_Philly.jpg", "type": "image", "content": "Squalor_of_Philly.jpg", "thumb": "Squalor_of_Philly.jpg", "linkTarget": "", "caption": "Squalor of Philly", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Squalor_of_Philly.jpg", "oldThumb": "Squalor_of_Philly.jpg" }, "10192": { "id": 10192, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 590725 }, "label": "Philadelphia Homes.jpg", "type": "image", "content": "PhiladelphiaHomes.jpg", "thumb": "PhiladelphiaHomes.jpg", "linkTarget": "", "caption": "Philadelphia Homes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia Homes.jpg", "oldThumb": "Philadelphia Homes.jpg" }, "10193": { "id": 10193, "size": { "content": { "width": 1824, "height": 1140 }, "thumb": { "width": 1824, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 539934 }, "label": "Philadelphia Streets.jpg", "type": "image", "content": "PhiladelphiaStreets.jpg", "thumb": "PhiladelphiaStreets.jpg", "linkTarget": "", "caption": "Philadelphia Streets", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philadelphia Streets.jpg", "oldThumb": "Philadelphia Streets.jpg" }, "10194": { "id": 10194, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 192744 }, "label": "Philly_Hoods.jpg", "type": "image", "content": "Philly_Hoods.jpg", "thumb": "Philly_Hoods.jpg", "linkTarget": "", "caption": "Philly Hoods", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:32", "filters": [ "Philly" ], "oldFilename": "Philly_Hoods.jpg", "oldThumb": "Philly_Hoods.jpg" }, "10195": { "id": 10195, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 240072 }, "label": "alfa romeo berlina 1700", "type": "image", "content": "Alfa_Romeo_Guilia_Auto_Portrait.jpg", "thumb": "Alfa_Romeo_Guilia_Auto_Portrait.jpg", "linkTarget": "", "caption": "Alfa Romeo Guila Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Alfa_Romeo_Guilia_Auto_Portrait.jpg", "oldThumb": "Alfa_Romeo_Guilia_Auto_Portrait.jpg" }, "10196": { "id": 10196, "size": { "content": { "width": 1556, "height": 1140 }, "thumb": { "width": 1556, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 220248 }, "label": "blue subaru brat portland oregon", "type": "image", "content": "Automobile_Portrait.jpg", "thumb": "Automobile_Portrait.jpg", "linkTarget": "", "caption": " Automobile Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Automobile_Portrait.jpg", "oldThumb": "Automobile_Portrait.jpg" }, "10197": { "id": 10197, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 244777 }, "label": "side view of a BMW 2002", "type": "image", "content": "Car_Portrait.jpg", "thumb": "Car_Portrait.jpg", "linkTarget": "", "caption": "Car Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.758Z", "filters": [ "Auto Portraits" ], "oldFilename": "Car_Portrait.jpg", "oldThumb": "Car_Portrait.jpg" }, "10198": { "id": 10198, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 176059 }, "label": "white chevy nova on a snowy portland block", "type": "image", "content": "Chevy_Nova_Auto_Portrait.jpg", "thumb": "Chevy_Nova_Auto_Portrait.jpg", "linkTarget": "", "caption": "Chevy Nova Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Chevy_Nova_Auto_Portrait.jpg", "oldThumb": "Chevy_Nova_Auto_Portrait.jpg" }, "10199": { "id": 10199, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 288076 }, "label": "green GMC motorhome on an oregon street", "type": "image", "content": "Classic_RV_Auto_Portrait.jpg", "thumb": "Classic_RV_Auto_Portrait.jpg", "linkTarget": "", "caption": "Classic RV Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Classic_RV_Auto_Portrait.jpg", "oldThumb": "Classic_RV_Auto_Portrait.jpg" }, "10200": { "id": 10200, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 201840 }, "label": "baby blue dodge dart", "type": "image", "content": "Dodge_Dart_Auto_Portrait.jpg", "thumb": "Dodge_Dart_Auto_Portrait.jpg", "linkTarget": "", "caption": "Dodge Dart Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Dodge_Dart_Auto_Portrait.jpg", "oldThumb": "Dodge_Dart_Auto_Portrait.jpg" }, "10201": { "id": 10201, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 222034 }, "label": "ford f150 camper at the oregon coast", "type": "image", "content": "Ford_Camper_Auto_Portrait.jpg", "thumb": "Ford_Camper_Auto_Portrait.jpg", "linkTarget": "", "caption": "Ford Camper Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Ford_Camper_Auto_Portrait.jpg", "oldThumb": "Ford_Camper_Auto_Portrait.jpg" }, "10202": { "id": 10202, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 243883 }, "label": "ford mustang two ghia edition gold", "type": "image", "content": "Ford_Mustang_Ghia_Auto_Portrait.jpg", "thumb": "Ford_Mustang_Ghia_Auto_Portrait.jpg", "linkTarget": "", "caption": "Ford Mustang Ghia Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Ford_Mustang_Ghia_Auto_Portrait.jpg", "oldThumb": "Ford_Mustang_Ghia_Auto_Portrait.jpg" }, "10203": { "id": 10203, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 167795 }, "label": "vintage ford box truck portland oregon", "type": "image", "content": "Ford_Truck_Auto_Portrait.jpg", "thumb": "Ford_Truck_Auto_Portrait.jpg", "linkTarget": "", "caption": "Ford Truck Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Ford_Truck_Auto_Portrait.jpg", "oldThumb": "Ford_Truck_Auto_Portrait.jpg" }, "10204": { "id": 10204, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 178482 }, "label": "vintage lincoln continental auto portrait", "type": "image", "content": "Lincoln_Continental_Auto_Portrait.jpg", "thumb": "Lincoln_Continental_Auto_Portrait.jpg", "linkTarget": "", "caption": "Lincoln Continental Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Lincoln_Continental_Auto_Portrait.jpg", "oldThumb": "Lincoln_Continental_Auto_Portrait.jpg" }, "10205": { "id": 10205, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 181385 }, "label": "Oldsmobile_Omega_ Auto_Portrait.jpg", "type": "image", "content": "Oldsmobile_Omega_Auto_Portrait.jpg", "thumb": "Oldsmobile_Omega_Auto_Portrait.jpg", "linkTarget": "", "caption": "Oldsmobile Omega Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Auto Portraits" ], "oldFilename": "Oldsmobile_Omega_ Auto_Portrait.jpg", "oldThumb": "Oldsmobile_Omega_ Auto_Portrait.jpg" }, "10206": { "id": 10206, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 232736 }, "label": "classic brown ford ranchero ute", "type": "image", "content": "Vintage_.jpg", "thumb": "Vintage_.jpg", "linkTarget": "", "caption": "Vintage_Auto", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_.jpg", "oldThumb": "Vintage_.jpg" }, "10207": { "id": 10207, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 174949 }, "label": "vintage classic cadillac sedan deville", "type": "image", "content": "Vintage_Auto_Portrait.jpg", "thumb": "Vintage_Auto_Portrait.jpg", "linkTarget": "", "caption": "Vintage Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Auto_Portrait.jpg", "oldThumb": "Vintage_Auto_Portrait.jpg" }, "10208": { "id": 10208, "size": { "content": { "width": 1556, "height": 1140 }, "thumb": { "width": 1556, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 216394 }, "label": "green hot rod chevy malibu coupe", "type": "image", "content": "Vintage_Car.jpg", "thumb": "Vintage_Car.jpg", "linkTarget": "", "caption": "Vintage Car", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Car.jpg", "oldThumb": "Vintage_Car.jpg" }, "10209": { "id": 10209, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 213746 }, "label": "classic red mini cooper vintage original", "type": "image", "content": "Vintage_Mini_Cooper_Auto_Portrait.jpg", "thumb": "Vintage_Mini_Cooper_Auto_Portrait.jpg", "linkTarget": "", "caption": "Vintage Mini Cooper Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.755Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Mini_Cooper_Auto_Portrait.jpg", "oldThumb": "Vintage_Mini_Cooper_Auto_Portrait.jpg" }, "10210": { "id": 10210, "size": { "content": { "width": 1728, "height": 1140 }, "thumb": { "width": 1728, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 300683 }, "label": "red ford f100 pickup", "type": "image", "content": "Vintage_Pickup_Portrait.jpg", "thumb": "Vintage_Pickup_Portrait.jpg", "linkTarget": "", "caption": "Vintage Pickup Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.755Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Pickup_Portrait.jpg", "oldThumb": "Vintage_Pickup_Portrait.jpg", "key": "10210" }, "10211": { "id": 10211, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 272174 }, "label": "Vintage_Plymouth_Portrait.jpg", "type": "image", "content": "Vintage_Plymouth_Portrait.jpg", "thumb": "Vintage_Plymouth_Portrait.jpg", "linkTarget": "", "caption": "Vintage Plymouth Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Plymouth_Portrait.jpg", "oldThumb": "Vintage_Plymouth_Portrait.jpg" }, "10212": { "id": 10212, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 157417 }, "label": "vintage saab 96 v4 ford tannus", "type": "image", "content": "Vintage_Saab_Portrait.jpg", "thumb": "Vintage_Saab_Portrait.jpg", "linkTarget": "", "caption": "Vintage Saab Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Saab_Portrait.jpg", "oldThumb": "Vintage_Saab_Portrait.jpg" }, "10213": { "id": 10213, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 271135 }, "label": "vintage green jeep cherokee SUV", "type": "image", "content": "Vintage_Truck_Portrait.jpg", "thumb": "Vintage_Truck_Portrait.jpg", "linkTarget": "", "caption": "Vintage Truck Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.755Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Truck_Portrait.jpg", "oldThumb": "Vintage_Truck_Portrait.jpg" }, "10214": { "id": 10214, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 244365 }, "label": "white mercedes van 408D", "type": "image", "content": "Vintage_Van_Portriat.jpg", "thumb": "Vintage_Van_Portriat.jpg", "linkTarget": "", "caption": "Vintage Van Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ], "oldFilename": "Vintage_Van_Portriat.jpg", "oldThumb": "Vintage_Van_Portriat.jpg" }, "10215": { "id": 10215, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 176210 }, "label": "red volkswagen beetle vintage classic car", "type": "image", "content": "Volkswagen_Beetle_Auto_Portrait.jpg", "thumb": "Volkswagen_Beetle_Auto_Portrait.jpg", "linkTarget": "", "caption": "Volkswagen Beetle Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.756Z", "filters": [ "Auto Portraits" ] }, "10216": { "id": 10216, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 225522 }, "label": "volvo 142 wagon front", "type": "image", "content": "Volvo_Wagon_Auto_Portrait.jpg", "thumb": "Volvo_Wagon_Auto_Portrait.jpg", "linkTarget": "", "caption": "Volvo Wagen Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Volvo_Wagon_Auto_Portrait.jpg", "oldThumb": "Volvo_Wagon_Auto_Portrait.jpg" }, "10217": { "id": 10217, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 1425, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 238943 }, "label": "beater winnebago Rv on the street", "type": "image", "content": "Winnebago_Auto_Portrait.jpg", "thumb": "Winnebago_Auto_Portrait.jpg", "linkTarget": "", "caption": "Winnebago Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T23:04:18.757Z", "filters": [ "Auto Portraits" ], "oldFilename": "Winnebago_Auto_Portrait.jpg", "oldThumb": "Winnebago_Auto_Portrait.jpg" }, "10218": { "id": 10218, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 174985 }, "label": "Bedroom_Shot_from_Above.jpg", "type": "image", "content": "Bedroom_Shot_from_Above.jpg", "thumb": "Bedroom_Shot_from_Above.jpg", "linkTarget": "", "caption": "Bedroom Shot from Above", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Bedroom_Shot_from_Above.jpg", "oldThumb": "Bedroom_Shot_from_Above.jpg" }, "10219": { "id": 10219, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 215277 }, "label": "keen boots at welding shop sparks brown", "type": "image", "content": "Boot_Photography.jpg", "thumb": "Boot_Photography.jpg", "linkTarget": "", "caption": "Boot Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive - New for SEO" ], "oldFilename": "Boot_Photography.jpg", "oldThumb": "Boot_Photography.jpg", "key": "10219", "postDate": "2023-02-21T20:37:42.668Z" }, "10220": { "id": 10220, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 308432 }, "label": "keen river shoe sandal at the beach", "type": "image", "content": "Footwear_Photography.jpg", "thumb": "Footwear_Photography.jpg", "linkTarget": "", "caption": "Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive - New for SEO" ], "oldFilename": "Footwear_Photography.jpg", "oldThumb": "Footwear_Photography.jpg", "key": "10220", "postDate": "2023-02-21T20:28:25.859Z" }, "10221": { "id": 10221, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 223822 }, "label": "keen hiking boot on a rocky shoreline blue brown", "type": "image", "content": "Footwear_Still_Life.jpg", "thumb": "Footwear_Still_Life.jpg", "linkTarget": "", "caption": "Footwear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive - New for SEO" ], "oldFilename": "Footwear_Still_Life.jpg", "oldThumb": "Footwear_Still_Life.jpg", "key": "10221", "postDate": "2023-02-21T20:28:25.859Z" }, "10222": { "id": 10222, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 158166 }, "label": "keen shoe on a doc at trilium lake oregon", "type": "image", "content": "Keen_Footwear_Still_Life.jpg", "thumb": "Keen_Footwear_Still_Life.jpg", "linkTarget": "", "caption": "Keen Footwear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive - New for SEO" ], "oldFilename": "Keen_Footwear_Still_Life.jpg", "oldThumb": "Keen_Footwear_Still_Life.jpg", "key": "10222", "postDate": "2023-02-21T20:28:25.859Z" }, "10223": { "id": 10223, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 403761 }, "label": "Nike_Product_Advertising.jpg", "type": "image", "content": "Nike_Product_Advertising.jpg", "thumb": "Nike_Product_Advertising.jpg", "linkTarget": "", "caption": "Nike Product Advertising", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Nike_Product_Advertising.jpg", "oldThumb": "Nike_Product_Advertising.jpg" }, "10224": { "id": 10224, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 263354 }, "label": "Nike_Product_Still_Life_Photography.jpg", "type": "image", "content": "Nike_Product_Still_Life_Photography.jpg", "thumb": "Nike_Product_Still_Life_Photography.jpg", "linkTarget": "", "caption": "Nike Product Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Nike_Product_Still_Life_Photography.jpg", "oldThumb": "Nike_Product_Still_Life_Photography.jpg" }, "10225": { "id": 10225, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 106546 }, "label": "nike snowboarding danny kass zoom Dk mark dean veca", "type": "image", "content": "Nike_Snowboard_Boot_Vignette.jpg", "thumb": "Nike_Snowboard_Boot_Vignette.jpg", "linkTarget": "", "caption": "Nike Snowboard Boot Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.641Z", "filters": [ "Archive - New for SEO" ], "oldFilename": "Nike_Snowboard_Boot_Vignette.jpg", "oldThumb": "Nike_Snowboard_Boot_Vignette.jpg", "key": "10225" }, "10226": { "id": 10226, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 399855 }, "label": "Nike_T-Shirt_Advertising.jpg", "type": "image", "content": "Nike_T-Shirt_Advertising.jpg", "thumb": "Nike_T-Shirt_Advertising.jpg", "linkTarget": "", "caption": "Nike T-Shirt Advertising", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Nike_T-Shirt_Advertising.jpg", "oldThumb": "Nike_T-Shirt_Advertising.jpg" }, "10227": { "id": 10227, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 417244 }, "label": "Nike_Tee_Advertising.jpg", "type": "image", "content": "Nike_Tee_Advertising.jpg", "thumb": "Nike_Tee_Advertising.jpg", "linkTarget": "", "caption": "Nike Tee Advertising", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.641Z", "filters": [ "Archive - New for SEO" ], "oldFilename": "Nike_Tee_Advertising.jpg", "oldThumb": "Nike_Tee_Advertising.jpg", "key": "10227" }, "10228": { "id": 10228, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 174131 }, "label": "Portrait_of_a_Bearded_Man.jpg", "type": "image", "content": "Portrait_of_a_Bearded_Man.jpg", "thumb": "Portrait_of_a_Bearded_Man.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Portrait_of_a_Bearded_Man.jpg", "oldThumb": "Portrait_of_a_Bearded_Man.jpg" }, "10229": { "id": 10229, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 218871 }, "label": "Portrait_of_a_Real_Man.jpg", "type": "image", "content": "Portrait_of_a_Real_Man.jpg", "thumb": "Portrait_of_a_Real_Man.jpg", "linkTarget": "", "caption": "Portrait of a Real Man", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Portrait_of_a_Real_Man.jpg", "oldThumb": "Portrait_of_a_Real_Man.jpg" }, "10230": { "id": 10230, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 1710, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 145790 }, "label": "Portrait_of_an_Intense_Man.jpg", "type": "image", "content": "Portrait_of_an_Intense_Man.jpg", "thumb": "Portrait_of_an_Intense_Man.jpg", "linkTarget": "", "caption": "Portrait of an Intense Man", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:33", "filters": [ "Archive - New for SEO" ], "oldFilename": "Portrait_of_an_Intense_Man.jpg", "oldThumb": "Portrait_of_an_Intense_Man.jpg" }, "10231": { "id": 10231, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 183681 }, "label": "Portrait_of_Bearded_Man.jpg", "type": "image", "content": "Portrait_of_Bearded_Man.jpg", "thumb": "Portrait_of_Bearded_Man.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Portrait_of_Bearded_Man.jpg", "oldThumb": "Portrait_of_Bearded_Man.jpg" }, "10232": { "id": 10232, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 218934 }, "label": "Real_Person_Portrait.jpg", "type": "image", "content": "Real_Person_Portrait.jpg", "thumb": "Real_Person_Portrait.jpg", "linkTarget": "", "caption": "Real Person Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Real_Person_Portrait.jpg", "oldThumb": "Real_Person_Portrait.jpg" }, "10233": { "id": 10233, "size": { "content": { "width": 1423, "height": 1140 }, "thumb": { "width": 1423, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 78863 }, "label": "Sony_Radio_Still_Life.jpg", "type": "image", "content": "Sony_Radio_Still_Life.jpg", "thumb": "Sony_Radio_Still_Life.jpg", "linkTarget": "", "caption": "Sony Radio Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Sony_Radio_Still_Life.jpg", "oldThumb": "Sony_Radio_Still_Life.jpg" }, "10234": { "id": 10234, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 1140, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 103570 }, "label": "Tradeswoman_Portrait.jpg", "type": "image", "content": "Tradeswoman_Portrait.jpg", "thumb": "Tradeswoman_Portrait.jpg", "linkTarget": "", "caption": "Tradeswoman Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Tradeswoman_Portrait.jpg", "oldThumb": "Tradeswoman_Portrait.jpg" }, "10235": { "id": 10235, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 130810 }, "label": "Travel_Agent_Desk_Still_Life.jpg", "type": "image", "content": "Travel_Agent_Desk_Still_Life.jpg", "thumb": "Travel_Agent_Desk_Still_Life.jpg", "linkTarget": "", "caption": "Travel Agent Desk Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Travel_Agent_Desk_Still_Life.jpg", "oldThumb": "Travel_Agent_Desk_Still_Life.jpg" }, "10236": { "id": 10236, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 222848 }, "label": "Vintage_Bookshelf_Vignette.jpg", "type": "image", "content": "Vintage_Bookshelf_Vignette.jpg", "thumb": "Vintage_Bookshelf_Vignette.jpg", "linkTarget": "", "caption": "Vintage Bookshelf Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Vintage_Bookshelf_Vignette.jpg", "oldThumb": "Vintage_Bookshelf_Vignette.jpg" }, "10237": { "id": 10237, "size": { "content": { "width": 1187, "height": 1140 }, "thumb": { "width": 1187, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 101551 }, "label": "Vintage_Phone_Vignette.jpg", "type": "image", "content": "Vintage_Phone_Vignette.jpg", "thumb": "Vintage_Phone_Vignette.jpg", "linkTarget": "", "caption": "Vintage Phone Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Vintage_Phone_Vignette.jpg", "oldThumb": "Vintage_Phone_Vignette.jpg" }, "10238": { "id": 10238, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 1596, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 215530 }, "label": "Work_Boots_Still_Life.jpg", "type": "image", "content": "Work_Boots_Still_Life.jpg", "thumb": "Work_Boots_Still_Life.jpg", "linkTarget": "", "caption": "Work Boots Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Work_Boots_Still_Life.jpg", "oldThumb": "Work_Boots_Still_Life.jpg" }, "10239": { "id": 10239, "size": { "content": { "width": 1628, "height": 1140 }, "thumb": { "width": 1628, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 515924 }, "label": "Portrait of a Bearded Man.jpg", "type": "image", "content": "PortraitofaBeardedMan.jpg", "thumb": "PortraitofaBeardedMan.jpg", "linkTarget": "", "caption": "Portrait of a bearded man", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Portrait of a Bearded Man.jpg", "oldThumb": "Portrait of a Bearded Man.jpg" }, "10240": { "id": 10240, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 814, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 126613 }, "label": "Girl_Shot_From_Above.jpg", "type": "image", "content": "Girl_Shot_From_Above.jpg", "thumb": "Girl_Shot_From_Above.jpg", "linkTarget": "", "caption": "Girl Shot from Above", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Girl_Shot_From_Above.jpg", "oldThumb": "Girl_Shot_From_Above.jpg" }, "10241": { "id": 10241, "size": { "content": { "width": 1265, "height": 1140 }, "thumb": { "width": 1265, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 84603 }, "label": "Athlete_in_Training.jpg", "type": "image", "content": "Athlete_in_Training.jpg", "thumb": "Athlete_in_Training.jpg", "linkTarget": "", "caption": "Athlete in Training", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Athlete_in_Training.jpg", "oldThumb": "Athlete_in_Training.jpg" }, "10242": { "id": 10242, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 75037 }, "label": "Athlete_Training.jpg", "type": "image", "content": "Athlete_Training.jpg", "thumb": "Athlete_Training.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Athlete_Training.jpg", "oldThumb": "Athlete_Training.jpg" }, "10243": { "id": 10243, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 95839 }, "label": "Outdoorwear_Photography.jpg", "type": "image", "content": "Outdoorwear_Photography.jpg", "thumb": "Outdoorwear_Photography.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Outdoorwear_Photography.jpg", "oldThumb": "Outdoorwear_Photography.jpg" }, "10244": { "id": 10244, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 1520, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 111215 }, "label": "Snow_Composite.jpg", "type": "image", "content": "Snow_Composite.jpg", "thumb": "Snow_Composite.jpg", "linkTarget": "", "caption": "Snow Composite", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Snow_Composite.jpg", "oldThumb": "Snow_Composite.jpg" }, "10245": { "id": 10245, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 59017 }, "label": "Training_Athlete.jpg", "type": "image", "content": "Training_Athlete.jpg", "thumb": "Training_Athlete.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Training_Athlete.jpg", "oldThumb": "Training_Athlete.jpg" }, "10246": { "id": 10246, "size": { "content": { "width": 826, "height": 1140 }, "thumb": { "width": 826, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 75322 }, "label": "Urban_Training_Athlete.jpg", "type": "image", "content": "Urban_Training_Athlete.jpg", "thumb": "Urban_Training_Athlete.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Urban_Training_Athlete.jpg", "oldThumb": "Urban_Training_Athlete.jpg" }, "10247": { "id": 10247, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 760, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 70856 }, "label": "Basketball_Apparel.jpg", "type": "image", "content": "Basketball_Apparel.jpg", "thumb": "Basketball_Apparel.jpg", "linkTarget": "", "caption": "Basketball Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Basketball_Apparel.jpg", "oldThumb": "Basketball_Apparel.jpg" }, "10248": { "id": 10248, "size": { "content": { "width": 1358, "height": 1140 }, "thumb": { "width": 1358, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 109476 }, "label": "Basketball_Athletic_Apparel.jpg", "type": "image", "content": "Basketball_Athletic_Apparel.jpg", "thumb": "Basketball_Athletic_Apparel.jpg", "linkTarget": "", "caption": "Basketball Athletic Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Basketball_Athletic_Apparel.jpg", "oldThumb": "Basketball_Athletic_Apparel.jpg" }, "10249": { "id": 10249, "size": { "content": { "width": 1681, "height": 1140 }, "thumb": { "width": 1681, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 311023 }, "label": "Training Apparel Photography.jpg", "type": "image", "content": "TrainingApparelPhotography.jpg", "thumb": "TrainingApparelPhotography.jpg", "linkTarget": "", "caption": "Training Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Training Apparel Photography.jpg", "oldThumb": "Training Apparel Photography.jpg" }, "10250": { "id": 10250, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 1710, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 246848 }, "label": "Training Athletes.jpg", "type": "image", "content": "TrainingAthletes.jpg", "thumb": "TrainingAthletes.jpg", "linkTarget": "", "caption": "Training Athletes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-03 18:22:34", "filters": [ "Archive - New for SEO" ], "oldFilename": "Training Athletes.jpg", "oldThumb": "Training Athletes.jpg" }, "10251": { "id": 10251, "size": { "content": { "width": 1478, "height": 1140 }, "thumb": { "width": 1478, "height": 1140 }, "featuredImage": { "width": false, "height": false }, "bytes": 242334 }, "label": "Beach_Trash_Collection.jpg", "type": "image", "content": "Beach_Trash_Collection.jpg", "thumb": "Beach_Trash_Collection.jpg", "linkTarget": "", "caption": "Beach Trash Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T02:22:34.000Z", "filters": [], "oldFilename": "Beach_Trash_Collection.jpg", "oldThumb": "Beach_Trash_Collection.jpg" }, "10254": { "id": 10254, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "[like]", "type": "link", "content": "http://jimgoldenstudio.com", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T04:47:52.000Z", "filters": [ "Footer Links" ] }, "10255": { "id": 10255, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "[email]", "type": "link", "content": "mailto:jim@jimgoldenstudio.com", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-04T04:57:06.000Z", "filters": [ "Footer Links" ], "key": "10255", "postDate": "2019-01-28T22:39:54.685Z" }, "10256": { "id": 10256, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 320231 }, "label": "eight track tape collection 8-track tape cartridges", "type": "image", "content": "8Track_Collection-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "8Track Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "8Track_Collection-copy1.jpg", "key": "10256", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "music", "tapes", "8-track" ], "searchable": true }, "10257": { "id": 10257, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 223330 }, "label": "beach garbage organized from dark to light on tan paper", "type": "image", "content": "Beach_Trash_Collection-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Beach Trash Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Beach_Trash_Collection-copy1.jpg", "key": "10257", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "gradient", "beach", "ocean", "plastics", "garbage" ], "searchable": true }, "10258": { "id": 10258, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 252097 }, "label": "classic boombox collection on dark blue background", "type": "image", "content": "Boombox_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Boombox Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Boombox_Collection.jpg", "key": "10258", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "boombox" ], "searchable": true }, "10259": { "id": 10259, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 255097 }, "label": "large camera collection from overhead on a white background", "type": "image", "content": "Camera_Laydown-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Camera Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-08T23:37:17.675Z", "filters": [ "Collections" ], "key": "10259", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "cameras" ], "searchable": true }, "10260": { "id": 10260, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186907 }, "label": "classic camping gear organized neatly on tan background ", "type": "image", "content": "Camping_Organized_Neatly.jpg", "thumb": "", "linkTarget": "", "caption": "Camping Gear Organized Neatly", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Collections" ], "oldFilename": "Camping_Organized_Neatly.jpg", "key": "10260", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden" ], "searchable": true }, "10261": { "id": 10261, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261059 }, "label": "vintage cell phones organized neatly", "type": "image", "content": "Cell_Phone_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Cell Phone Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Cell_Phone_Laydown.jpg", "key": "10261", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "cellphones", "tech" ], "searchable": true }, "10262": { "id": 10262, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 192889 }, "label": "colorful vintage housewear collection on blue background", "type": "image", "content": "Colorful_Housewares_Collection-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Colorful Housewares Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Collections" ], "oldFilename": "Colorful_Housewares_Collection-copy1.jpg", "key": "10262", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "blue", "orange", "vintage" ], "searchable": true }, "10263": { "id": 10263, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261937 }, "label": "ryan Dungey motocross gear at KTM factory", "type": "image", "content": "ESPN_Motocross_Gear-up.jpg", "thumb": "", "linkTarget": "", "caption": "ESPN Motocross Gear-up", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "key": "10263" }, "10264": { "id": 10264, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 177594 }, "label": "vintage rifle and hunting gear collection", "type": "image", "content": "Firearm_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Firearm Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.449Z", "filters": [ "Collections" ], "oldFilename": "Firearm_Collection.jpg", "key": "10264", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "vintage", "hunting", "guns" ], "searchable": true }, "10265": { "id": 10265, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 191517 }, "label": "classic instruments arranged on a light blue background", "type": "image", "content": "Instruments_Laydown-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Instruments Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Instruments_Laydown-copy1.jpg", "key": "10265", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "instruments" ], "searchable": true }, "10266": { "id": 10266, "size": { "content": { "width": 2291, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 289811 }, "label": "north portland makers tools for the kiln building", "type": "image", "content": "Kiln_Commercial_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Kiln Commercial Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.449Z", "filters": [ "Collections" ], "oldFilename": "Kiln_Commercial_Collection.jpg", "key": "10266", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "artisans", "tools" ], "searchable": true }, "10267": { "id": 10267, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 234924 }, "label": "giant lock collection organized neatly", "type": "image", "content": "Lock_Collection_Photo.jpg", "thumb": "", "linkTarget": "", "caption": "Lock Collection Photo", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Lock_Collection_Photo.jpg", "key": "10267", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "padlock", "lock", "vintage" ], "searchable": true }, "10268": { "id": 10268, "searchable": true, "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "scissors" ], "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 258254 }, "label": "enormous scissor collection on a white background", "type": "image", "content": "Scissor_Collection-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Scissor Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Collections" ] }, "10269": { "id": 10269, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 161716 }, "label": "simpson strong tie connectors on a dark blue background", "type": "image", "content": "Simpson_Strong-tie_Poster.jpg", "thumb": "", "linkTarget": "", "caption": "Simpson Strong-tie Poster", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Collections" ], "oldFilename": "Simpson_Strong-tie_Poster.jpg", "key": "10269", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "simpson strong tie" ], "searchable": true }, "10270": { "id": 10270, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 212355 }, "label": "vintage video game consoles and cartridges on a yellow background", "type": "image", "content": "Videogame_Collection_Photo.jpg", "thumb": "", "linkTarget": "", "caption": "Videogame Collection Photo", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Collections" ], "oldFilename": "Videogame_Collection_Photo.jpg", "key": "10270", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "yellow", "vintage", "videogames" ], "searchable": true }, "10271": { "id": 10271, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 210486 }, "label": "walnut studiolo bike gear photo ", "type": "image", "content": "Walnut_Studiolo_Bike_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Walnut Studiolo Bike Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.449Z", "filters": [ "Collections" ], "oldFilename": "Walnut_Studiolo_Bike_Collection.jpg", "key": "10271", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "bikes" ], "searchable": true }, "10272": { "id": 10272, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 128948 }, "label": "clear glassware in a random pattern", "type": "image", "content": "Glassware_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Glassware Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Patterns", "Still Life" ], "oldFilename": "Glassware_Still_Life.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10272" }, "10273": { "id": 10273, "size": { "content": { "width": 1140, "height": 855 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 124160 }, "label": "cannonade track bike frame assortment", "type": "image", "content": "Graphic_Bike_Frames.jpg", "thumb": "", "linkTarget": "", "caption": "Graphic Bike Frames", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Patterns", "Collections" ], "oldFilename": "Graphic_Bike_Frames.jpg", "key": "10273", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "track bike", "cannondale" ], "searchable": true }, "10274": { "id": 10274, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 76373 }, "label": "colorful umbrellas arranged in a graphic pattern", "type": "image", "content": "Graphic_Umbrella_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Patterns" ], "oldFilename": "Graphic_Umbrella_Still_Life.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10274" }, "10275": { "id": 10275, "size": { "content": { "width": 1604, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 327358 }, "label": "Graphic_Videotapes", "type": "image", "content": "Graphic_Videotapes.jpg", "thumb": "", "linkTarget": "", "caption": "Graphic Videotapes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:17:36", "filters": [ "Patterns" ], "oldFilename": "Graphic_Videotapes.jpg" }, "10276": { "id": 10276, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 111328 }, "label": "dark photo of pots and pans with soup in them", "type": "image", "content": "Housewares_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Housewares Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.441Z", "filters": [ "Patterns" ], "oldFilename": "Housewares_Still_Life-copy1.jpg", "postDate": "2019-02-07T19:41:24.273Z" }, "10277": { "id": 10277, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 29580 }, "label": "Murdered_Out_Big_Wheel", "type": "image", "content": "Murdered_Out_Big_Wheel.jpg", "thumb": "", "linkTarget": "", "caption": "Murdered Out Big Wheel", "overrides": {}, "featuredImage": "", "dateAdded": "2022-05-25T23:20:19.658Z", "filters": [ "Murdered Out" ], "oldFilename": "Murdered_Out_Big_Wheel.jpg", "keywords": [ "murdered out", "black on black", "dark", "moody", "still life", "studio", "sets" ], "searchable": true, "key": "10277" }, "10278": { "id": 10278, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 25368 }, "label": "little red wagon painted matte black aka murdered out", "type": "image", "content": "Murdered_Out_Red_Wagon.jpg", "thumb": "", "linkTarget": "", "caption": "Murdered Out Red Wagon", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.440Z", "filters": [ "Murdered Out" ], "oldFilename": "Murdered_Out_Red_Wagon.jpg", "postDate": "2019-02-09T20:17:39.157Z", "keywords": [ "murdered out", "black on black", "dark", "moody", "still life", "studio", "sets" ], "searchable": true }, "10279": { "id": 10279, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 44306 }, "label": "Murdered_Out_Shopping_Cart", "type": "image", "content": "Murdered_Out_Shopping_Cart.jpg", "thumb": "", "linkTarget": "", "caption": "Murdered Out Shopping Cart", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-01T02:31:29.184Z", "filters": [ "Murdered Out" ], "key": "10279", "keywords": [ "murdered out", "black on black", "dark", "moody", "still life", "studio", "sets" ], "searchable": true }, "10280": { "id": 10280, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 20038 }, "label": "flexible flyer sled painted matte black on a black background", "type": "image", "content": "Murdered_Out_Sled.jpg", "thumb": "", "linkTarget": "", "caption": "Murdered Out Sled", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.441Z", "filters": [ "Murdered Out" ], "oldFilename": "Murdered_Out_Sled.jpg", "postDate": "2019-02-09T20:17:39.157Z", "keywords": [ "murdered out", "black on black", "dark", "moody", "still life", "studio", "sets" ], "searchable": true }, "10281": { "id": 10281, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 20632 }, "label": "Murdered_Out_Walker", "type": "image", "content": "Murdered_Out_Walker.jpg", "thumb": "", "linkTarget": "", "caption": "Murdered Out Walker", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-05T00:02:21.989Z", "filters": [ "Murdered Out" ], "key": "10281", "keywords": [ "murdered out", "black on black", "dark", "moody", "still life", "studio", "sets" ], "searchable": true }, "10282": { "id": 10282, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 29767 }, "label": "murdered out wheel barrow, rattle canned matte black", "type": "image", "content": "Murdered_Out_Wheel_Barrow.jpg", "thumb": "", "linkTarget": "", "caption": "Murdered Out Wheel Barrow", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-01T02:31:29.184Z", "filters": [ "Murdered Out" ], "key": "10282", "postDate": "2019-02-09T20:17:39.157Z", "keywords": [ "murdered out", "black on black", "dark", "moody", "still life", "studio", "sets" ], "searchable": true }, "10283": { "id": 10283, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 36230 }, "label": "vintage bingo cage kinfolk magazine", "type": "image", "content": "Bingo_Game_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Bingo Game Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life" ], "oldFilename": "Bingo_Game_Still_Life.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10283" }, "10284": { "id": 10284, "size": { "content": { "width": 914, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 123115 }, "label": "Butcher_Blocks_Still_Life", "type": "image", "content": "Butcher_Blocks_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Butcher Blocks Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:52:07", "filters": [ "Still Life" ], "oldFilename": "Butcher_Blocks_Still_Life.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10285": { "id": 10285, "size": { "content": { "width": 860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 67914 }, "label": "backpacking gear fishing pole and puffy coat on a tan background", "type": "image", "content": "Camping_Apparel_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Camping Apparel Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life" ], "oldFilename": "Camping_Apparel_Still_Life.jpg", "postDate": "2022-04-18T19:05:52.325Z", "key": "10285" }, "10286": { "id": 10286, "size": { "content": { "width": 905, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 66930 }, "label": "simple image of camping equipment and a guitar", "type": "image", "content": "Camping_Gear_Vignette.jpg", "thumb": "", "linkTarget": "", "caption": "Camping Gear Vignette", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life" ], "oldFilename": "Camping_Gear_Vignette.jpg", "postDate": "2022-04-18T19:05:52.325Z", "key": "10286" }, "10287": { "id": 10287, "size": { "content": { "width": 2000, "height": 1442 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 166146 }, "label": "Food_Still_Life", "type": "image", "content": "Food_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Food Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:52:09", "filters": [ "Still Life" ], "oldFilename": "Food_Still_Life.jpg" }, "10288": { "id": 10288, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 56269 }, "label": "Gift_Still_Life_Photography", "type": "image", "content": "Gift_Still_Life_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Gift Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T00:52:09.000Z", "filters": [], "oldFilename": "Gift_Still_Life_Photography.jpg" }, "10289": { "id": 10289, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 56980 }, "label": "Hiking_Footwear_Still_Life", "type": "image", "content": "Hiking_Footwear_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Hiking Footwear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:52:10", "filters": [ "Still Life" ], "oldFilename": "Hiking_Footwear_Still_Life.jpg" }, "10290": { "id": 10290, "size": { "content": { "width": 831, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 52776 }, "label": "white tennis apparel on clay background", "type": "image", "content": "Tennis_Apparel_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Tennis Apparel Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:34:41.080Z", "filters": [ "Still Life" ], "oldFilename": "Tennis_Apparel_Still_Life.jpg", "postDate": "2020-05-04T22:37:37.004Z" }, "10291": { "id": 10291, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 48609 }, "label": "Vintage_Canteen_Still_Life", "type": "image", "content": "Vintage_Canteen_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Canteen Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:52:11", "filters": [ "Still Life" ], "oldFilename": "Vintage_Canteen_Still_Life.jpg" }, "10292": { "id": 10292, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84118 }, "label": "Vintage_Fishing_Net_Still_Life", "type": "image", "content": "Vintage_Fishing_Net_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Fishing Net Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:52:11", "filters": [ "Still Life" ], "oldFilename": "Vintage_Fishing_Net_Still_Life.jpg" }, "10293": { "id": 10293, "size": { "content": { "width": 918, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 49683 }, "label": "Vintage_Lantern_Still_Life", "type": "image", "content": "Vintage_Lantern_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Lantern Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:52:12", "filters": [ "Still Life" ], "oldFilename": "Vintage_Lantern_Still_Life.jpg" }, "10294": { "id": 10294, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 44331 }, "label": "photo of a gunstock camera zoom lens on black", "type": "image", "content": "Camera_Dark-Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Camera Dark Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.441Z", "filters": [ "Dark Still Life" ], "oldFilename": "Camera_Dark-Still_Life.jpg", "postDate": "2022-04-18T18:56:38.705Z" }, "10295": { "id": 10295, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 53970 }, "label": "Chainsaw_Still_life", "type": "image", "content": "Chainsaw_Still_life.jpg", "thumb": "", "linkTarget": "", "caption": "Chainsaw Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:59:07", "filters": [ "Dark Still Life" ], "oldFilename": "Chainsaw_Still_life.jpg", "postDate": "2019-02-07T19:43:38.970Z" }, "10296": { "id": 10296, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108070 }, "label": "Dark_Stereo_Still_Life", "type": "image", "content": "Dark_Stereo_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Stereo Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:59:07", "filters": [ "Dark Still Life" ], "oldFilename": "Dark_Stereo_Still_Life.jpg", "postDate": "2022-04-18T20:57:39.429Z" }, "10297": { "id": 10297, "size": { "content": { "width": 1584, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 27768 }, "label": "Rifle_Still_Life", "type": "image", "content": "Rifle_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Rifle Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:59:08", "filters": [ "Dark Still Life" ], "oldFilename": "Rifle_Still_Life.jpg" }, "10298": { "id": 10298, "size": { "content": { "width": 1471, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 59720 }, "label": "Saw_Still_Life", "type": "image", "content": "Saw_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "hands with a wooden handle on black background", "overrides": {}, "featuredImage": "", "dateAdded": "2022-06-08T22:58:38.318Z", "filters": [ "Dark Still Life" ], "oldFilename": "Saw_Still_Life.jpg", "postDate": "2022-04-18T19:41:36.701Z", "key": "10298", "keywords": [ "moody", "saw", "product", "still life", "photo", "hand tool", "old school" ], "searchable": true }, "10299": { "id": 10299, "size": { "content": { "width": 1471, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 79716 }, "label": "Turntable_Still_Life", "type": "image", "content": "Turntable_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Turntable Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:59:10", "filters": [ "Dark Still Life" ], "oldFilename": "Turntable_Still_Life.jpg" }, "10300": { "id": 10300, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 44499 }, "label": "Vintage_Stereo_Still_Life", "type": "image", "content": "Vintage_Stereo_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Stereo Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 17:59:10", "filters": [ "Dark Still Life" ], "oldFilename": "Vintage_Stereo_Still_Life.jpg", "postDate": "2022-04-18T20:57:42.214Z" }, "10301": { "id": 10301, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 161292 }, "label": "Crawfish_Food_Still_Life", "type": "image", "content": "Crawfish_Food_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Crawfish Food Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T01:10:59.000Z", "filters": [], "oldFilename": "Crawfish_Food_Still_Life.jpg" }, "10302": { "id": 10302, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 121225 }, "label": "Kinfolk_Food_Still_Life", "type": "image", "content": "Food_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Kinfolk Food Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 18:11:00", "filters": [ "Still Life" ], "oldFilename": "Food_Still_Life-copy1.jpg" }, "10303": { "id": 10303, "searchable": true, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 116111 }, "label": "hot dog pop and chips on a red tray", "type": "image", "content": "Hot_Dog_Food_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Hot Dog Food Still Life", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-07T20:12:18.097Z", "filters": [ "Still Life", "Food" ], "key": "10303" }, "10304": { "id": 10304, "size": { "content": { "width": 1860, "height": 543 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 54016 }, "label": "Medical_Campaign_Still_Life", "type": "image", "content": "Ouchless_Campaign_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Medical Campaign Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 18:11:03", "filters": [ "Still Life" ], "oldFilename": "Ouchless_Campaign_Still_Life.jpg" }, "10305": { "id": 10305, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 65298 }, "label": "Sandwich_Food_Still_Life", "type": "image", "content": "Sandwich_Food_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Sandwich Food Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T01:11:03.000Z", "filters": [], "oldFilename": "Sandwich_Food_Still_Life.jpg" }, "10306": { "id": 10306, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 213705 }, "label": "Graphic_Speakers", "type": "image", "content": "Graphic_Speakers.jpg", "thumb": "", "linkTarget": "", "caption": "Graphic Speakers", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 18:18:27", "filters": [ "Patterns" ], "oldFilename": "Graphic_Speakers.jpg" }, "10307": { "id": 10307, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 135832 }, "label": "Drawer_Still-Life_Photography", "type": "image", "content": "Drawer_Still-Life_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Drawer Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T01:31:52.000Z", "filters": [], "oldFilename": "Drawer_Still-Life_Photography.jpg" }, "10308": { "id": 10308, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 93741 }, "label": "Organized_Drawer_Still_Life", "type": "image", "content": "Organized_Drawer_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Organized Drawer Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T01:31:52.000Z", "filters": [], "oldFilename": "Organized_Drawer_Still_Life.jpg" }, "10309": { "id": 10309, "size": { "content": { "width": 1140, "height": 1538 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 283713 }, "label": "Shoe_Sole_Pattern_Still-Life", "type": "image", "content": "Shoe_Sole_Pattern_Still-Life.jpg", "thumb": "", "linkTarget": "", "caption": "Shoe Sole Pattern Still-Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 18:57:18", "filters": [ "Patterns" ], "oldFilename": "Shoe_Sole_Pattern_Still-Life.jpg" }, "10310": { "id": 10310, "size": { "content": { "width": 1140, "height": 1596 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 91687 }, "label": "Dark_Womens_Footwear", "type": "image", "content": "Dark_Womens_Footwear.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Womens Footwear", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:22", "filters": [ "Footwear" ], "oldFilename": "Dark_Womens_Footwear.jpg", "postDate": "2019-02-12T17:38:20.406Z" }, "10311": { "id": 10311, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 86007 }, "label": "looking at a nikeSB Janoski shoe from below on a great background", "type": "image", "content": "Floating_Shoe_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Floating Shoe Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.480Z", "filters": [ "Footwear" ] }, "10312": { "id": 10312, "size": { "content": { "width": 1140, "height": 1677 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 77461 }, "label": "Floating_Shoe_Still-Life", "type": "image", "content": "Floating_Shoe_Still-Life.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:23", "filters": [ "Footwear" ], "oldFilename": "Floating_Shoe_Still-Life.jpg" }, "10313": { "id": 10313, "size": { "content": { "width": 846, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 50146 }, "label": "Footwear_On_Feet", "type": "image", "content": "Footwear_On_Feet.jpg", "thumb": "", "linkTarget": "", "caption": "Footwear on Feet", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:23", "filters": [ "Footwear" ], "oldFilename": "Footwear_On_Feet.jpg", "postDate": "2019-02-12T17:37:19.921Z" }, "10314": { "id": 10314, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 78663 }, "label": "nikeSB eric koston footwear floating on a green background", "type": "image", "content": "Footwear_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.480Z", "filters": [ "Footwear" ] }, "10315": { "id": 10315, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 90745 }, "label": "Footwear_Sole_Photography", "type": "image", "content": "Footwear_Sole_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Footwear Sole Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:25", "filters": [ "Footwear" ], "oldFilename": "Footwear_Sole_Photography.jpg" }, "10316": { "id": 10316, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106808 }, "label": "Jet_Shoe_Footwear_Photography", "type": "image", "content": "Jet_Shoe_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Jet Shoe Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:26", "filters": [ "Footwear" ], "oldFilename": "Jet_Shoe_Footwear_Photography.jpg" }, "10317": { "id": 10317, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 102046 }, "label": "nike basketball hyperfuse shoe on blue background", "type": "image", "content": "Jet_Shoe_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Jet Shoe Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:11.402Z", "filters": [ "Footwear" ], "oldFilename": "Jet_Shoe_Still_Life.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10318": { "id": 10318, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 184380 }, "label": "Nike_Footwear_Photography", "type": "image", "content": "Nike_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T02:00:27.000Z", "filters": [], "oldFilename": "Nike_Footwear_Photography.jpg" }, "10319": { "id": 10319, "size": { "content": { "width": 1140, "height": 1480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 58744 }, "label": "turquoise nikeSB one shot shoes skateboarding", "type": "image", "content": "Nike_Sneaker_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Sneaker Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.479Z", "filters": [ "Footwear" ] }, "10320": { "id": 10320, "size": { "content": { "width": 1140, "height": 1480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 51285 }, "label": "grey nikeSB one shot shoes skateboarding", "type": "image", "content": "Nike_Tennis_Shoe_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Tennis Shoe Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.479Z", "filters": [ "Footwear" ], "oldFilename": "Nike_Tennis_Shoe_Still_Life.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10321": { "id": 10321, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 111654 }, "label": "nike raining shoe with free sole", "type": "image", "content": "Shoe_Detail_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Shoe Detail Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.480Z", "filters": [ "Footwear" ], "oldFilename": "Shoe_Detail_Still_Life.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10322": { "id": 10322, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 187010 }, "label": "Shoe_Photography", "type": "image", "content": "Shoe_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Shoe Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:30", "filters": [ "Footwear" ], "oldFilename": "Shoe_Photography.jpg", "postDate": "2019-02-12T17:36:31.064Z" }, "10323": { "id": 10323, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 87075 }, "label": "nike lunar lon footbed being twisted on white background", "type": "image", "content": "Shoe_Sole_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Shoe Sole Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.480Z", "filters": [ "Footwear" ] }, "10324": { "id": 10324, "size": { "content": { "width": 1860, "height": 819 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 172215 }, "label": "pile of all white nike air force 1", "type": "image", "content": "Tennis_Shoe_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Tennis Shoe Photography", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-06T22:17:56.575Z", "filters": [ "Footwear" ] }, "10325": { "id": 10325, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 80914 }, "label": "Twisting_Shoe_Still_Life", "type": "image", "content": "Twisting_Shoe_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Twisting Shoe Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-10 19:00:32", "filters": [ "Footwear" ], "oldFilename": "Twisting_Shoe_Still_Life.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10326": { "id": 10326, "size": { "content": { "width": 1522, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 137821 }, "label": "Athleticwear_Layflat", "type": "image", "content": "Athleticwear_Layflat.jpg", "thumb": "", "linkTarget": "", "caption": "Athleticwear Layflat", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:01:55", "filters": [ "Apparel" ], "oldFilename": "Athleticwear_Layflat.jpg" }, "10327": { "id": 10327, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 74017 }, "label": "Dark_Athletic_Wear_Photography", "type": "image", "content": "Athleticwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Athletic Wear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:01:58.000Z", "filters": [], "oldFilename": "Athleticwear_Photography.jpg" }, "10328": { "id": 10328, "size": { "content": { "width": 1293, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 147873 }, "label": "Denim_Apparel_Photography", "type": "image", "content": "Denim_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Denim Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:01.000Z", "filters": [], "oldFilename": "Denim_Apparel_Photography.jpg" }, "10329": { "id": 10329, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 79629 }, "label": "Football_Uniform_Photography", "type": "image", "content": "Football_Uniform_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Football Uniform Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:03.000Z", "filters": [], "oldFilename": "Football_Uniform_Photography.jpg" }, "10330": { "id": 10330, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 285953 }, "label": "Levi_Nike_Apparel_Laydown", "type": "image", "content": "Levi_Nike_Apparel_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Levi Nike Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:05.000Z", "filters": [], "oldFilename": "Levi_Nike_Apparel_Laydown.jpg" }, "10331": { "id": 10331, "size": { "content": { "width": 1542, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 125055 }, "label": "Light_Nike_Sporting_Apparel", "type": "image", "content": "Light_Nike_Sporting_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Light Nike Sporting Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:07.000Z", "filters": [], "oldFilename": "Light_Nike_Sporting_Apparel.jpg" }, "10332": { "id": 10332, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 99221 }, "label": "Night_Apparel_Photography", "type": "image", "content": "Night_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Night Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:09.000Z", "filters": [], "oldFilename": "Night_Apparel_Photography.jpg" }, "10333": { "id": 10333, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 65186 }, "label": "Night_Fashion_Photography", "type": "image", "content": "Night_Fashion_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Night Fashion Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:10.000Z", "filters": [], "oldFilename": "Night_Fashion_Photography.jpg" }, "10334": { "id": 10334, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148500 }, "label": "nikeSB prod2 footwear in a leather bag ", "type": "image", "content": "Nike_Footwear_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.479Z", "filters": [ "Apparel" ], "oldFilename": "Nike_Footwear_Photography-copy1.jpg", "postDate": "2020-05-04T22:25:48.022Z" }, "10335": { "id": 10335, "size": { "content": { "width": 948, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 130346 }, "label": "nike surf jacket hanging in front of a clean photo", "type": "image", "content": "Nike_Snowboarding_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Snowboarding Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:45.872Z", "filters": [ "Apparel" ], "postDate": "2020-05-04T22:37:53.443Z" }, "10336": { "id": 10336, "size": { "content": { "width": 1275, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 103286 }, "label": "Nike_Soccer_Apparel", "type": "image", "content": "Nike_Soccer_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Soccer Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:17.000Z", "filters": [], "oldFilename": "Nike_Soccer_Apparel.jpg" }, "10337": { "id": 10337, "size": { "content": { "width": 1860, "height": 998 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219772 }, "label": "Nike_Summer_Sports_Apparel", "type": "image", "content": "Nike_Summer_Sports_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Summer Sports Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:20.000Z", "filters": [], "oldFilename": "Nike_Summer_Sports_Apparel.jpg" }, "10338": { "id": 10338, "size": { "content": { "width": 940, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 104371 }, "label": "Nike_Surf_Apparel_Photography", "type": "image", "content": "Nike_Surf_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Surf Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:02:21", "filters": [ "Apparel" ], "oldFilename": "Nike_Surf_Apparel_Photography.jpg", "postDate": "2020-05-04T22:37:53.443Z" }, "10339": { "id": 10339, "size": { "content": { "width": 1542, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 153331 }, "label": "Soccer_Sportswear_Layflat", "type": "image", "content": "Soccer_Sportswear_Layflat.jpg", "thumb": "", "linkTarget": "", "caption": "Soccer Sportswear Layflat", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:23.000Z", "filters": [], "oldFilename": "Soccer_Sportswear_Layflat.jpg" }, "10340": { "id": 10340, "size": { "content": { "width": 1551, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 124034 }, "label": "Sporting_Apparel_Laydown", "type": "image", "content": "Sporting_Apparel_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Sporting Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:27.000Z", "filters": [], "oldFilename": "Sporting_Apparel_Laydown.jpg" }, "10341": { "id": 10341, "size": { "content": { "width": 1860, "height": 815 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 185612 }, "label": "Summer_Athleticwear_Laydown", "type": "image", "content": "Summer_Athleticwear_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Summer Athleticwear Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:30.000Z", "filters": [], "oldFilename": "Summer_Athleticwear_Laydown.jpg" }, "10342": { "id": 10342, "size": { "content": { "width": 1192, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 114971 }, "label": "Training_Apparel_Layflat", "type": "image", "content": "Training_Apparel_Layflat.jpg", "thumb": "", "linkTarget": "", "caption": "Training Apparel Layflat", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:02:34", "filters": [ "Apparel" ], "oldFilename": "Training_Apparel_Layflat.jpg" }, "10343": { "id": 10343, "size": { "content": { "width": 1522, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 164242 }, "label": "Womens_Training_Apparel", "type": "image", "content": "Womens_Training_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Womens Training Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T20:02:36.000Z", "filters": [], "oldFilename": "Womens_Training_Apparel.jpg" }, "10344": { "id": 10344, "size": { "content": { "width": 1589, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328579 }, "label": "Apparel_T-shirt_Photography", "type": "image", "content": "Apparel_T-shirt_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Apparel T-shirt Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:10", "filters": [ "Archive" ], "oldFilename": "Apparel_T-shirt_Photography.jpg" }, "10345": { "id": 10345, "size": { "content": { "width": 1589, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 355708 }, "label": "Apparel_Teeshirt_Photography", "type": "image", "content": "Apparel_Teeshirt_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Apparel Teeshirt Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:14", "filters": [ "Archive" ], "oldFilename": "Apparel_Teeshirt_Photography.jpg" }, "10346": { "id": 10346, "size": { "content": { "width": 1149, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 88066 }, "label": "Baby_Lifestyle_Portrait", "type": "image", "content": "Baby_Lifestyle_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Baby Lifestyle Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:16", "filters": [ "Archive" ], "oldFilename": "Baby_Lifestyle_Portrait.jpg" }, "10347": { "id": 10347, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193544 }, "label": "Camping_Lifestyle_Photography", "type": "image", "content": "Camping_Lifestyle_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Camping Lifestyle Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:22", "filters": [ "Archive" ], "oldFilename": "Camping_Lifestyle_Photography.jpg", "postDate": "2023-02-21T20:31:16.407Z" }, "10348": { "id": 10348, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 279862 }, "label": "Catching_Crawdads_Studio_Shoot", "type": "image", "content": "Catching_Crawdads_Studio_Shoot.jpg", "thumb": "", "linkTarget": "", "caption": "Catching Crawdads Studio Shoot", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:28", "filters": [ "Archive" ], "oldFilename": "Catching_Crawdads_Studio_Shoot.jpg", "postDate": "2023-02-21T20:31:16.407Z" }, "10349": { "id": 10349, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 63689 }, "label": "fly fisherman with a fish on studio photo", "type": "image", "content": "Fisherman_Studio_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Fisherman Studio Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.643Z", "filters": [ "Archive" ], "oldFilename": "Fisherman_Studio_Portrait.jpg", "key": "10349" }, "10350": { "id": 10350, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 201193 }, "label": "Kayaking_Studio_Photography", "type": "image", "content": "Kayaking_Studio_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Kayaking Studio Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:36", "filters": [ "Archive" ], "oldFilename": "Kayaking_Studio_Photography.jpg", "postDate": "2023-02-21T20:31:16.407Z" }, "10351": { "id": 10351, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 194840 }, "label": "Portland_Lifestyle_Photography", "type": "image", "content": "Portland_Lifestyle_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Lifestyle Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:40", "filters": [ "Archive" ], "oldFilename": "Portland_Lifestyle_Photography.jpg", "postDate": "2023-02-21T20:31:16.407Z", "key": "10351" }, "10352": { "id": 10352, "size": { "content": { "width": 1140, "height": 1381 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 203374 }, "label": "Snowboarding_Footwear_Photography", "type": "image", "content": "Snowboarding_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Snowboarding Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:44", "filters": [ "Archive" ], "oldFilename": "Snowboarding_Footwear_Photography.jpg" }, "10353": { "id": 10353, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 57315 }, "label": "Woman_Contractor_Portrait", "type": "image", "content": "Woman_Contractor_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Woman Contractor Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 13:46:46", "filters": [ "Archive" ], "oldFilename": "Woman_Contractor_Portrait.jpg" }, "10354": { "id": 10354, "size": { "content": { "width": 1429, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150276 }, "label": "keen boots still life on construction site", "type": "image", "content": "Work_Boot_Footwear_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Work Boot Footwear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive" ], "oldFilename": "Work_Boot_Footwear_Still_Life.jpg", "key": "10354", "postDate": "2023-02-21T20:37:42.668Z" }, "10355": { "id": 10355, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 94657 }, "label": "sony betamax video tapes", "type": "image", "content": "Relics_of_Technology_Betamax.jpg", "thumb": "", "linkTarget": "", "caption": "Betamax", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Betamax.jpg" }, "10356": { "id": 10356, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 151431 }, "label": "Relics_of_Technology_Diskette", "type": "image", "content": "Relics_of_Technology_Diskette.jpg", "thumb": "", "linkTarget": "", "caption": "Diskette", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 14:17:10", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Diskette.jpg" }, "10357": { "id": 10357, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 210451 }, "label": "motorola dyna tac brick cell phone animation GIF relic", "type": "image", "content": "Relics_of_Technology_DynaTAC.gif", "thumb": "", "linkTarget": "", "caption": "DynaTAC Cell Phone", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ] }, "10358": { "id": 10358, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 38392 }, "label": "Relics_of_Technology_DynaTAC", "type": "image", "content": "Relics_of_Technology_DynaTAC.jpg", "thumb": "", "linkTarget": "", "caption": "DynaTAC Cell Phone", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 14:17:12", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_DynaTAC.jpg" }, "10359": { "id": 10359, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 213920 }, "label": "Relics_of_Technology_DynaTAC", "type": "video", "content": "Relics_of_Technology_DynaTAC.mp4", "thumb": "", "linkTarget": "", "caption": "Relics of Technology DynaTAC", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:13.000Z", "filters": [], "oldFilename": "Relics_of_Technology_DynaTAC.mp4" }, "10360": { "id": 10360, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269416 }, "label": "3 1/2 inch micro floppy disk in a pattern", "type": "image", "content": "Relics_of_Technology_Floppy.jpg", "thumb": "", "linkTarget": "", "caption": "3-1/2\" Microfloppy", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Floppy.jpg" }, "10361": { "id": 10361, "size": { "content": { "width": 1551, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 139895 }, "label": "iomega jaz disk removable storage media on tan paper", "type": "image", "content": "Relics_of_Technology_Jaz_Disk.jpg", "thumb": "", "linkTarget": "", "caption": "Jaz Disk", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Jaz_Disk.jpg" }, "10362": { "id": 10362, "size": { "content": { "width": 1525, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219773 }, "label": "punched cards in a pattern on green", "type": "image", "content": "Relics_of_Technology_Punched_Cards.jpg", "thumb": "", "linkTarget": "", "caption": "Punched Cards", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Punched_Cards.jpg" }, "10363": { "id": 10363, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 3583580 }, "label": "vintage analog rotary telephone, GTE relic", "type": "image", "content": "Relics_of_Technology_Rotary_Phone.gif", "thumb": "", "linkTarget": "", "caption": "Rotary Phone", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ] }, "10364": { "id": 10364, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 51082 }, "label": "Relics_of_Technology_Rotary_Phone", "type": "image", "content": "Relics_of_Technology_Rotary_Phone.jpg", "thumb": "", "linkTarget": "", "caption": "Rotary Phone", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 14:17:29", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Rotary_Phone.jpg" }, "10365": { "id": 10365, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 415644 }, "label": "Relics_of_Technology_Rotary_Phone", "type": "video", "content": "Relics_of_Technology_Rotary_Phone.mp4", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Rotary Phone", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:32.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Rotary_Phone.mp4" }, "10366": { "id": 10366, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 591354 }, "label": "Relics_of_Technology_Slide_Projector", "type": "image", "content": "Relics_of_Technology_Slide_Projector.gif", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Slide Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:35.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector.gif" }, "10367": { "id": 10367, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 50555 }, "label": "Relics_of_Technology_Slide_Projector", "type": "image", "content": "Relics_of_Technology_Slide_Projector.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Slide Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:36.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector.jpg" }, "10368": { "id": 10368, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1188841 }, "label": "Relics_of_Technology_Slide_Projector", "type": "video", "content": "Relics_of_Technology_Slide_Projector.mp4", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Slide Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:41.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector.mp4" }, "10369": { "id": 10369, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 551667 }, "label": "vintage super 8 film projector on a green background ", "type": "image", "content": "Relics_of_Technology_Super_8_Projector.gif", "thumb": "", "linkTarget": "", "caption": "Super 8 Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "key": "10369", "searchable": true }, "10370": { "id": 10370, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 66345 }, "label": "Relics_of_Technology_Super_8_Projector", "type": "image", "content": "Relics_of_Technology_Super_8_Projector.jpg", "thumb": "", "linkTarget": "", "caption": "Super 8 Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 14:17:44", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Super_8_Projector.jpg" }, "10371": { "id": 10371, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 652196 }, "label": "Relics_of_Technology_Super_8_Projector", "type": "video", "content": "Relics_of_Technology_Super_8_Projector.mp4", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Super 8 Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:48.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Super_8_Projector.mp4" }, "10372": { "id": 10372, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 133649 }, "label": "vintage syquest88 removable media disk", "type": "image", "content": "Relics_of_Technology_SyQuest.jpg", "thumb": "", "linkTarget": "", "caption": "Syquest Disk", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_SyQuest.jpg" }, "10373": { "id": 10373, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1571271 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter.gif", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Typewriter", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:56.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter.gif" }, "10374": { "id": 10374, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 71552 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Typewriter", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:17:58.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter.jpg" }, "10375": { "id": 10375, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 744886 }, "label": "Relics_of_Technology_Typewriter", "type": "video", "content": "Relics_of_Technology_Typewriter.mp4", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Typewriter", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:18:02.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter.mp4" }, "10376": { "id": 10376, "size": { "content": { "width": 1577, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 147879 }, "label": "group of VHS tapes in a pattern on blue paper", "type": "image", "content": "Relics_of_Technology_VHS.jpg", "thumb": "", "linkTarget": "", "caption": "VHS Tape", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_VHS.jpg" }, "10377": { "id": 10377, "size": { "content": { "width": 1590, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 114590 }, "label": "Relics_of_Technology_Videodisc", "type": "image", "content": "Relics_of_Technology_Videodisc.jpg", "thumb": "", "linkTarget": "", "caption": "Videodisc", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11 14:18:05", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Videodisc.jpg" }, "10378": { "id": 10378, "size": { "content": { "width": 1551, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 191670 }, "label": "colorful zip disks in a pattern on tan paper", "type": "image", "content": "Relics_of_Technology_Zip_Discs.jpg", "thumb": "", "linkTarget": "", "caption": "Zip Disc", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Zip_Discs.jpg" }, "10379": { "id": 10379, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 71428 }, "label": "35mm slide caddy, to take transparencies to go", "type": "image", "content": "Relics_of_Technology_35mm_Slide_Caddy.jpg", "thumb": "", "linkTarget": "", "caption": "35mm Slide Caddy", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_35mm_Slide_Caddy.jpg" }, "10380": { "id": 10380, "size": { "content": { "width": 1530, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 200479 }, "label": "vintage analog 45RPM 7 inch vinyl records", "type": "image", "content": "Relics_of_Technology_45s.jpg", "thumb": "", "linkTarget": "", "caption": "7\" EP", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_45s.jpg" }, "10381": { "id": 10381, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 724691 }, "label": "Relics_of_Technology_Reel_to_Reel", "type": "image", "content": "Relics_of_Technology_Reel_to_Reel.gif", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Reel to Reel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:40:59.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Reel_to_Reel.gif" }, "10382": { "id": 10382, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 94721 }, "label": "Relics_of_Technology_Reel_to_Reel", "type": "image", "content": "Relics_of_Technology_Reel_to_Reel.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Reel to Reel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:41:01.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Reel_to_Reel.jpg" }, "10383": { "id": 10383, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 874570 }, "label": "Relics_of_Technology_Reel_to_Reel", "type": "video", "content": "Relics_of_Technology_Reel_to_Reel.mp4", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Reel to Reel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:41:10.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Reel_to_Reel.mp4" }, "10384": { "id": 10384, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 230103 }, "label": "Relics_of_Technology_Viewmaster", "type": "image", "content": "Relics_of_Technology_Viewmaster.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Viewmaster", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-11T21:41:14.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Viewmaster.jpg" }, "10385": { "id": 10385, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 129422 }, "label": "holiday ornament collection topdown", "type": "image", "content": "Holiday_Greeting_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Holiday Greeting Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Holiday_Greeting_Collection.jpg", "key": "10385", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "holiday" ], "searchable": true }, "10386": { "id": 10386, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 114084 }, "label": "Jim_Golden", "type": "image", "content": "Jim_Golden-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-12T00:46:18.000Z", "filters": [], "oldFilename": "Jim_Golden-copy1.jpg" }, "10387": { "id": 10387, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 162762 }, "label": "Jim-Golden-Portland", "type": "image", "content": "Jim-Golden-Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-12T00:46:19.000Z", "filters": [], "oldFilename": "Jim-Golden-Portland.jpg" }, "10400": { "id": 10400, "size": { "content": { "width": 1430, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 158027 }, "label": "crawfish and potatoes treat new orleans jazz fest", "type": "image", "content": "Crawfish_Food_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Crawfish Food Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.322Z", "filters": [ "Still Life", "Food" ], "oldFilename": "Crawfish_Food_Still_Life-copy1.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10400" }, "10401": { "id": 10401, "size": { "content": { "width": 1430, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 77205 }, "label": "grilled cheese and tomato soup for lunch", "type": "image", "content": "Sandwich_Food_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Sandwich Food Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.322Z", "filters": [ "Still Life", "Food" ], "oldFilename": "Sandwich_Food_Still_Life-copy1.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10401" }, "10402": { "id": 10402, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2350014 }, "label": "Relics_of_Technology_Slide_Projector", "type": "image", "content": "Relics_of_Technology_Slide_Projector-copy1.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:37:03.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector-copy1.gif" }, "10403": { "id": 10403, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 50555 }, "label": "Relics_of_Technology_Slide_Projector", "type": "image", "content": "Relics_of_Technology_Slide_Projector-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:37:04.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector-copy1.jpg" }, "10404": { "id": 10404, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1188841 }, "label": "Relics_of_Technology_Slide_Projector", "type": "video", "content": "Relics_of_Technology_Slide_Projector-copy1.mp4", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:37:07.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector-copy1.mp4" }, "10405": { "id": 10405, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1353801 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter-copy1.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:37:11.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter-copy1.gif" }, "10406": { "id": 10406, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 71552 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:37:11.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter-copy1.jpg" }, "10407": { "id": 10407, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 744886 }, "label": "Relics_of_Technology_Typewriter", "type": "video", "content": "Relics_of_Technology_Typewriter-copy1.mp4", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:37:14.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter-copy1.mp4" }, "10408": { "id": 10408, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2350014 }, "label": "vintage 35mm slide projector animated GIF", "type": "image", "content": "Relics_of_Technology_Slide_Projector-copy2.gif", "thumb": "", "linkTarget": "", "caption": "Slide Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Slide_Projector-copy2.gif" }, "10409": { "id": 10409, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 50555 }, "label": "Relics_of_Technology_Slide_Projector", "type": "image", "content": "Relics_of_Technology_Slide_Projector-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Slide Projector", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-17 18:38:45", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Slide_Projector-copy2.jpg" }, "10410": { "id": 10410, "size": { "content": { "width": 640, "height": 480 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1188841 }, "label": "Relics_of_Technology_Slide_Projector", "type": "video", "content": "Relics_of_Technology_Slide_Projector-copy2.mp4", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:38:48.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Slide_Projector-copy2.mp4" }, "10411": { "id": 10411, "size": { "content": { "width": 1260, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 221936 }, "label": "Levi_Nike_Apparel_Laydown", "type": "image", "content": "Levi_Nike_Apparel_Laydown-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:44:20.000Z", "filters": [], "oldFilename": "Levi_Nike_Apparel_Laydown-copy1.jpg" }, "10412": { "id": 10412, "size": { "content": { "width": 1260, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 221936 }, "label": "Levi_Nike_Apparel_Laydown", "type": "image", "content": "Levi_Nike_Apparel_Laydown-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Levi Nike Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:44:57.000Z", "filters": [], "oldFilename": "Levi_Nike_Apparel_Laydown-copy2.jpg" }, "10413": { "id": 10413, "size": { "content": { "width": 1293, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 176483 }, "label": "Denim_Apparel_Photography", "type": "image", "content": "Denim_Apparel_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:50:01.000Z", "filters": [], "oldFilename": "Denim_Apparel_Photography-copy1.jpg" }, "10414": { "id": 10414, "size": { "content": { "width": 1293, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 176483 }, "label": "Denim_Apparel_Photography", "type": "image", "content": "Denim_Apparel_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Denim Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:50:31.000Z", "filters": [], "oldFilename": "Denim_Apparel_Photography-copy2.jpg" }, "10415": { "id": 10415, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 46172 }, "label": "Nike_Pro_Combat_Apparel_1", "type": "image", "content": "Nike_Pro_Combat_Apparel_1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:53:18.000Z", "filters": [], "oldFilename": "Nike_Pro_Combat_Apparel_1.jpg" }, "10416": { "id": 10416, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 47618 }, "label": "Nike_Pro_Combat_Apparel_2", "type": "image", "content": "Nike_Pro_Combat_Apparel_2.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:53:19.000Z", "filters": [], "oldFilename": "Nike_Pro_Combat_Apparel_2.jpg" }, "10417": { "id": 10417, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 80714 }, "label": "Sportswear_Apparel", "type": "image", "content": "Sportswear_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Sportswear Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:54:02.000Z", "filters": [], "oldFilename": "Sportswear_Apparel.jpg" }, "10418": { "id": 10418, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 117136 }, "label": "Nike_Sportswear_Apparel", "type": "image", "content": "Nike_Sportswear_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Sportswear Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:54:26.000Z", "filters": [], "oldFilename": "Nike_Sportswear_Apparel.jpg" }, "10419": { "id": 10419, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 188235 }, "label": "Sportswear_Apparel_Droplets", "type": "image", "content": "Sportswear_Apparel_Droplets.jpg", "thumb": "", "linkTarget": "", "caption": "Sportswear Apparel Droplets", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:54:53.000Z", "filters": [], "oldFilename": "Sportswear_Apparel_Droplets.jpg" }, "10420": { "id": 10420, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 202106 }, "label": "Sportswear_Drifit_Apparel", "type": "image", "content": "Sportswear_Drifit_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Sportswear Drifit Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:55:47.000Z", "filters": [], "oldFilename": "Sportswear_Drifit_Apparel.jpg" }, "10421": { "id": 10421, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 107994 }, "label": "Nike_Sportswear_Apparel_on_Model", "type": "image", "content": "Nike_Sportswear_Apparel_on_Model.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Sportswear Apparel on Model", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T01:56:15.000Z", "filters": [], "oldFilename": "Nike_Sportswear_Apparel_on_Model.jpg" }, "10424": { "id": 10424, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148760 }, "label": "elephant", "type": "image", "content": "elephant.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T02:04:08.000Z", "filters": [], "oldFilename": "elephant.jpg" }, "10431": { "id": 10431, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 154613 }, "label": "Studio", "type": "image", "content": "Studio.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T02:04:14.000Z", "filters": [], "oldFilename": "Studio.jpg" }, "10439": { "id": 10439, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 154613 }, "label": "Jim_Golden_Studio_Toys", "type": "image", "content": "Jim_Golden_Studio_Toys.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Studio Toys", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T02:06:52.000Z", "filters": [], "oldFilename": "Jim_Golden_Studio_Toys.jpg" }, "10441": { "id": 10441, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 1000, "height": 547 }, "bytes": 0, "pageImages": [] }, "label": "About the Studio", "type": "html", "content": "Jim Golden Studio has joined forces with the talented creatives at District Collective, located in Portland's Hollywood District. The JGS team keeps your project rolling smoothly and in budget by anticipating production issues and excelling at customer service. A seasoned crew of lighting techs, digital techs and stylists takes your project from concept to post-production in one seamless loop.\n\nFacilities include a 3000 sq ft shooting area, client lounge, WiFi and parking.", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "xxDC-STUDIO.jpg", "dateAdded": "2017-01-31T22:02:41.147Z", "filters": [], "key": "10441" }, "10442": { "id": 10442, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1161823 }, "label": "Organized_Drawer_Still_Life", "type": "image", "content": "Organized_Drawer_Still_Life.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T19:16:25.000Z", "filters": [], "oldFilename": "Organized_Drawer_Still_Life.gif" }, "10443": { "id": 10443, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1161823 }, "label": "Organized_Drawer_Still_Life", "type": "image", "content": "Organized_Drawer_Still_Life-copy1.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T19:19:17.000Z", "filters": [], "oldFilename": "Organized_Drawer_Still_Life-copy1.gif" }, "10444": { "id": 10444, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1161823 }, "label": "Still_Life_Movement", "type": "image", "content": "Still_Life_Movement.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18 12:21:58", "filters": [ "Still Life" ], "oldFilename": "Still_Life_Movement.gif" }, "10445": { "id": 10445, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 160946 }, "label": "Womens_Athleticwear_Photography", "type": "image", "content": "Womens_Athleticwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Womens Athleticwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T19:29:40.000Z", "filters": [], "oldFilename": "Womens_Athleticwear_Photography.jpg" }, "10446": { "id": 10446, "size": { "content": { "width": 846, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 56459 }, "label": "Gift_Still_Life_Photography", "type": "image", "content": "Gift_Still_Life_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18 12:32:24", "filters": [ "Still Life" ], "oldFilename": "Gift_Still_Life_Photography-copy1.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10447": { "id": 10447, "size": { "content": { "width": 1556, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 99130 }, "label": "Dark_Gun_Still-life", "type": "image", "content": "Dark_Gun_Still-life.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Gun Still-life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T19:50:02.000Z", "filters": [], "oldFilename": "Dark_Gun_Still-life.jpg" }, "10448": { "id": 10448, "size": { "content": { "width": 1463, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 90943 }, "label": "Dark_Firearms", "type": "image", "content": "Dark_Firearms.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Firearms", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T19:50:22.000Z", "filters": [], "oldFilename": "Dark_Firearms.jpg" }, "10449": { "id": 10449, "size": { "content": { "width": 1547, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 88101 }, "label": "Gun_Still_Life", "type": "image", "content": "Gun_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Gun Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18 12:50:37", "filters": [ "Dark Still Life" ], "oldFilename": "Gun_Still_Life.jpg" }, "10450": { "id": 10450, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 88954 }, "label": "Nike_Pro_Combat_Apparel", "type": "image", "content": "Nike_Pro_Combat_Apparel.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Pro Combat Apparel", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18T20:01:28.000Z", "filters": [], "oldFilename": "Nike_Pro_Combat_Apparel.jpg" }, "10451": { "id": 10451, "size": { "content": { "width": 1836, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 128247 }, "label": "Vintage_Still_Life", "type": "image", "content": "Vintage_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:18:13.000Z", "filters": [], "oldFilename": "Vintage_Still_Life.jpg" }, "10452": { "id": 10452, "size": { "content": { "width": 1836, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 102394 }, "label": "Camping_Still_Life_Photography", "type": "image", "content": "Camping_Still_Life_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Camping Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:18:17.000Z", "filters": [], "oldFilename": "Camping_Still_Life_Photography.jpg" }, "10453": { "id": 10453, "size": { "content": { "width": 1530, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 49595 }, "label": "Collection_Still_Life", "type": "image", "content": "Collection_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Collection Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18 17:18:28", "filters": [ "Still Life" ], "oldFilename": "Collection_Still_Life.jpg" }, "10454": { "id": 10454, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328317 }, "label": "Texas_Uniform_Photographer", "type": "image", "content": "Texas_Uniform_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "NIKE footwear", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:21:59.000Z", "filters": [], "oldFilename": "Texas_Uniform_Photographer.jpg" }, "10455": { "id": 10455, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 371032 }, "label": "Uniform_Apparel_Photography", "type": "image", "content": "Uniform_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "NIKE footwear", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:22:01.000Z", "filters": [], "oldFilename": "Uniform_Apparel_Photography.jpg" }, "10456": { "id": 10456, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328317 }, "label": "Texas_Uniform_Photographer", "type": "image", "content": "Texas_Uniform_Photographer-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Texas Uniform Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:22:20.000Z", "filters": [], "oldFilename": "Texas_Uniform_Photographer-copy1.jpg" }, "10457": { "id": 10457, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 371032 }, "label": "Uniform_Apparel_Photography", "type": "image", "content": "Uniform_Apparel_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Uniform Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:22:22.000Z", "filters": [], "oldFilename": "Uniform_Apparel_Photography-copy1.jpg" }, "10458": { "id": 10458, "size": { "content": { "width": 1761, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 131508 }, "label": "adidas running shoe on orange black and yellow background", "type": "image", "content": "adidas_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "adidas Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:51.479Z", "filters": [ "Footwear" ], "oldFilename": "adidas_Footwear_Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10459": { "id": 10459, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 107532 }, "label": "adidas_Footwear_Still_Life", "type": "image", "content": "adidas_Footwear_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "adidas Footwear Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-18 17:26:11", "filters": [ "Footwear" ], "oldFilename": "adidas_Footwear_Still_Life.jpg" }, "10460": { "id": 10460, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 289515 }, "label": "Case_of_Base_Collection", "type": "image", "content": "Case_of_Base_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:29:15.000Z", "filters": [], "oldFilename": "Case_of_Base_Collection.jpg" }, "10461": { "id": 10461, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 289515 }, "label": "case of bass suitcases on an angle", "type": "image", "content": "Case_of_Bass_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Case of Bass Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Case_of_Bass_Collection.jpg", "key": "10461", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "bass", "speakers", "suitcase" ], "searchable": true }, "10468": { "id": 10468, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 154613 }, "label": "Jim_Golden_Studio_Toys", "type": "image", "content": "Jim_Golden_Studio_Toys-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T00:36:11.000Z", "filters": [], "oldFilename": "Jim_Golden_Studio_Toys-copy1.jpg" }, "10470": { "id": 10470, "size": { "content": { "width": 1686, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 39884 }, "label": "Scissor_Still_Life", "type": "image", "content": "Scissor_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Scissor Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 12:46:14", "filters": [ "Still Life" ], "oldFilename": "Scissor_Still_Life.jpg" }, "10471": { "id": 10471, "size": { "content": { "width": 1686, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 47827 }, "label": "Scissor_Still-Life", "type": "image", "content": "Scissor_Still-Life.jpg", "thumb": "", "linkTarget": "", "caption": "Scissor Still-Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T19:46:16.000Z", "filters": [], "oldFilename": "Scissor_Still-Life.jpg" }, "10472": { "id": 10472, "size": { "content": { "width": 1764, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 105463 }, "label": "old lantern and a worn pair of hiking boots", "type": "image", "content": "Camping_Still_Life_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Camping Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life" ], "oldFilename": "Camping_Still_Life_Photography-copy1.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10472" }, "10473": { "id": 10473, "size": { "content": { "width": 1764, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 130046 }, "label": "orange canteen and a blue fishing net on tan background", "type": "image", "content": "Vintage_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life" ], "oldFilename": "Vintage_Still_Life-copy1.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10473" }, "10474": { "id": 10474, "size": { "content": { "width": 1546, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 86441 }, "label": "Ho13_YA_Gear_Up_Soccer_Boys_0552", "type": "image", "content": "Ho13_YA_Gear_Up_Soccer_Boys_0552.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T20:21:40.000Z", "filters": [], "oldFilename": "Ho13_YA_Gear_Up_Soccer_Boys_0552.jpg" }, "10475": { "id": 10475, "size": { "content": { "width": 1546, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 86441 }, "label": "Ho13_YA_Gear_Up_Soccer_Boys_0552", "type": "image", "content": "Ho13_YA_Gear_Up_Soccer_Boys_0552-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "tester", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T20:22:13.000Z", "filters": [], "oldFilename": "Ho13_YA_Gear_Up_Soccer_Boys_0552-copy1.jpg" }, "10476": { "id": 10476, "size": { "content": { "width": 1445, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 111817 }, "label": "Soccer_Sportswear_Layflat", "type": "image", "content": "Soccer_Sportswear_Layflat-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Soccer Sportswear Layflat", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 13:26:02", "filters": [ "Apparel" ], "oldFilename": "Soccer_Sportswear_Layflat-copy1.jpg", "postDate": "2019-02-07T00:40:57.273Z" }, "10477": { "id": 10477, "size": { "content": { "width": 1686, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 47386 }, "label": "Scissor_Still_Life", "type": "image", "content": "Scissor_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19T20:42:19.000Z", "filters": [], "oldFilename": "Scissor_Still_Life-copy1.jpg" }, "10478": { "id": 10478, "size": { "content": { "width": 1686, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 47386 }, "label": "Portland_Still_Life_Photography", "type": "image", "content": "Portland_Still_Life_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 13:42:58", "filters": [ "Still Life" ], "oldFilename": "Portland_Still_Life_Photography.jpg" }, "10479": { "id": 10479, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 56945 }, "label": "Arborist_Portrait", "type": "image", "content": "Arborist_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Arborist Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:19:56", "filters": [ "Archive" ], "oldFilename": "Arborist_Portrait.jpg" }, "10480": { "id": 10480, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 53362 }, "label": "Firefighter_Portrait", "type": "image", "content": "Firefighter_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Firefighter Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:19:57", "filters": [ "Archive" ], "oldFilename": "Firefighter_Portrait.jpg" }, "10481": { "id": 10481, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84762 }, "label": "Portland_Bike_Shop_Portrait", "type": "image", "content": "Portland_Bike_Shop_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Bike Shop Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:19:57", "filters": [ "Archive" ], "oldFilename": "Portland_Bike_Shop_Portrait.jpg" }, "10482": { "id": 10482, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 49568 }, "label": "Portland_Brewery_Portrait", "type": "image", "content": "Portland_Brewery_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Brewery Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:19:58", "filters": [ "Archive" ], "oldFilename": "Portland_Brewery_Portrait.jpg" }, "10483": { "id": 10483, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 87387 }, "label": "Portland_Cyclist_Photography", "type": "image", "content": "Portland_Cyclist_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Cyclist Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:19:59", "filters": [ "Archive" ], "oldFilename": "Portland_Cyclist_Photography.jpg" }, "10484": { "id": 10484, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 65272 }, "label": "Portland_Firefighter_Portrait", "type": "image", "content": "Portland_Firefighter_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Firefighter Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:19:59", "filters": [ "Archive" ], "oldFilename": "Portland_Firefighter_Portrait.jpg" }, "10485": { "id": 10485, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 68663 }, "label": "Portland_Person_Portrait", "type": "image", "content": "Portland_Person_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Person Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:20:00", "filters": [ "Archive" ], "oldFilename": "Portland_Person_Portrait.jpg" }, "10486": { "id": 10486, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 98593 }, "label": "Portland_Portrait_Photography", "type": "image", "content": "Portland_Portrait_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Portrait Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:20:01", "filters": [ "Archive" ], "oldFilename": "Portland_Portrait_Photography.jpg" }, "10487": { "id": 10487, "size": { "content": { "width": 913, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 43745 }, "label": "Portland_Real_Person_Portraits", "type": "image", "content": "Portland_Real_Person_Portraits.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Real Person Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-19 14:20:01", "filters": [ "Archive" ], "oldFilename": "Portland_Real_Person_Portraits.jpg" }, "10488": { "id": 10488, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 215530 }, "label": "keen boots at mechanic shop red black", "type": "image", "content": "Portland_Footwear_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Footwear Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive" ], "oldFilename": "Portland_Footwear_Photographer.jpg", "key": "10488", "postDate": "2023-02-21T20:37:42.668Z" }, "10489": { "id": 10489, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 126613 }, "label": "young woman in her bedroom crying on the phone", "type": "image", "content": "Portland_Topdown_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Topdown Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive" ], "oldFilename": "Portland_Topdown_Portrait.jpg", "key": "10489" }, "10490": { "id": 10490, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174985 }, "label": "young man passed out in a messy room", "type": "image", "content": "Topdown_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Topdown Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.642Z", "filters": [ "Archive" ], "oldFilename": "Topdown_Portrait.jpg", "key": "10490" }, "10491": { "id": 10491, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186684 }, "label": "California_Auto_Portrait", "type": "image", "content": "California_Auto_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "California Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:03", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "California_Auto_Portrait.jpg", "key": "10491" }, "10492": { "id": 10492, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 206833 }, "label": "California_RV_Culture", "type": "image", "content": "California_RV_Culture.jpg", "thumb": "", "linkTarget": "", "caption": "California RV Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:04", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "California_RV_Culture.jpg" }, "10493": { "id": 10493, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198632 }, "label": "California_RV_Kulture", "type": "image", "content": "California_RV_Kulture.jpg", "thumb": "", "linkTarget": "", "caption": "California RV Kulture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:05", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "California_RV_Kulture.jpg" }, "10494": { "id": 10494, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 192724 }, "label": "California_RV_Portrait", "type": "image", "content": "California_RV_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "California RV Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:06", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "California_RV_Portrait.jpg" }, "10495": { "id": 10495, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 292207 }, "label": "JGS_RV_Culture", "type": "image", "content": "JGS_RV_Culture.jpg", "thumb": "", "linkTarget": "", "caption": "JGS RV Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:07", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "JGS_RV_Culture.jpg" }, "10496": { "id": 10496, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 172360 }, "label": "JGS_RV_Kulture", "type": "image", "content": "JGS_RV_Kulture.jpg", "thumb": "", "linkTarget": "", "caption": "JGS RV Kulture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:08", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "JGS_RV_Kulture.jpg" }, "10497": { "id": 10497, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 190030 }, "label": "Jim_Golden_RV_Culture", "type": "image", "content": "Jim_Golden_RV_Culture.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden RV Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:09", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Jim_Golden_RV_Culture.jpg" }, "10498": { "id": 10498, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 197967 }, "label": "Jim_Golden_RV_Kulture", "type": "image", "content": "Jim_Golden_RV_Kulture.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden RV Kulture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:09", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Jim_Golden_RV_Kulture.jpg" }, "10499": { "id": 10499, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 147055 }, "label": "Jim_Golden_RV_Portrait", "type": "image", "content": "Jim_Golden_RV_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden RV Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:10", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Jim_Golden_RV_Portrait.jpg" }, "10500": { "id": 10500, "size": { "content": { "width": 3079, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 399688 }, "label": "Jim_Golden_RV_Portraits", "type": "image", "content": "Jim_Golden_RV_Portraits.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden RV Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:11", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Jim_Golden_RV_Portraits.jpg" }, "10501": { "id": 10501, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174945 }, "label": "Oregon_Auto_Portrait", "type": "image", "content": "Oregon_Auto_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:12", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Oregon_Auto_Portrait.jpg" }, "10502": { "id": 10502, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 253876 }, "label": "Oregon_RV_Culture", "type": "image", "content": "Oregon_RV_Culture.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon RV Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:13", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Oregon_RV_Culture.jpg" }, "10503": { "id": 10503, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 180022 }, "label": "Oregon_RV_Kulture", "type": "image", "content": "Oregon_RV_Kulture.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon RV Kulture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:14", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Oregon_RV_Kulture.jpg" }, "10504": { "id": 10504, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 220292 }, "label": "Portland_Auto_Culture", "type": "image", "content": "Portland_Auto_Culture.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Auto Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:15", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_Auto_Culture.jpg" }, "10505": { "id": 10505, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150123 }, "label": "Portland_Auto_Photography", "type": "image", "content": "Portland_Auto_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Auto Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:15", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_Auto_Photography.jpg" }, "10506": { "id": 10506, "size": { "content": { "width": 1140, "height": 776 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178974 }, "label": "Portland_Auto_Portrait", "type": "image", "content": "Portland_Auto_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:16", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_Auto_Portrait.jpg" }, "10507": { "id": 10507, "size": { "content": { "width": 1140, "height": 855 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193995 }, "label": "Portland_Itasca_Portrait", "type": "image", "content": "Portland_Itasca_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Itasca Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:17", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_Itasca_Portrait.jpg" }, "10508": { "id": 10508, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 187515 }, "label": "Portland_RV_Culture", "type": "image", "content": "Portland_RV_Culture.jpg", "thumb": "", "linkTarget": "", "caption": "Portland RV Culture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:18", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_RV_Culture.jpg" }, "10509": { "id": 10509, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 171554 }, "label": "Portland_RV_Kulture", "type": "image", "content": "Portland_RV_Kulture.jpg", "thumb": "", "linkTarget": "", "caption": "Portland RV Kulture", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:18", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_RV_Kulture.jpg" }, "10510": { "id": 10510, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 153789 }, "label": "Portland_RV_Portrait", "type": "image", "content": "Portland_RV_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Portland RV Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:19", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Portland_RV_Portrait.jpg" }, "10511": { "id": 10511, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 145512 }, "label": "Vintage_Auto_Portrait", "type": "image", "content": "Vintage_Auto_Portrait-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Auto Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:19", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Vintage_Auto_Portrait-copy1.jpg" }, "10512": { "id": 10512, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193286 }, "label": "Vintage_RV_Portrait", "type": "image", "content": "Vintage_RV_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage RV Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 11:47:20", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "Vintage_RV_Portrait.jpg" }, "10513": { "id": 10513, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 200022 }, "label": "RV_Portrait", "type": "image", "content": "RV_Portrait.jpg", "thumb": "", "linkTarget": "", "caption": "RV Portrait", "overrides": {}, "featuredImage": "", "dateAdded": "2014-03-20 14:41:32", "filters": [ "Left Coast RV Kulture" ], "oldFilename": "RV_Portrait.jpg" }, "10514": { "id": 10514, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219108 }, "label": "Cape_Meares_Beach_House", "type": "image", "content": "Cape_Meares_Beach_House.jpg", "thumb": "", "linkTarget": "", "caption": "Cape Meares Beach House", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:07", "filters": [ "New Going Coastal" ], "oldFilename": "Cape_Meares_Beach_House.jpg" }, "10515": { "id": 10515, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 183407 }, "label": "Coast_Dwelling_Portraits", "type": "image", "content": "Coast_Dwelling_Portraits.jpg", "thumb": "", "linkTarget": "", "caption": "Coastal Dwelling Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:08", "filters": [ "New Going Coastal" ], "oldFilename": "Coast_Dwelling_Portraits.jpg" }, "10516": { "id": 10516, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 157501 }, "label": "Coast_Portraits", "type": "image", "content": "Coast_Portraits.jpg", "thumb": "", "linkTarget": "", "caption": "Coastal Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:09", "filters": [ "New Going Coastal" ], "oldFilename": "Coast_Portraits.jpg" }, "10517": { "id": 10517, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178615 }, "label": "Going_Coastal", "type": "image", "content": "Going_Coastal.jpg", "thumb": "", "linkTarget": "", "caption": "Going Coastal", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:10", "filters": [ "New Going Coastal" ], "oldFilename": "Going_Coastal.jpg" }, "10518": { "id": 10518, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 203343 }, "label": "JGS_Going_Coastal", "type": "image", "content": "JGS_Going_Coastal.jpg", "thumb": "", "linkTarget": "", "caption": "JGS Going Coastal", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:11", "filters": [ "New Going Coastal" ], "oldFilename": "JGS_Going_Coastal.jpg" }, "10519": { "id": 10519, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 218996 }, "label": "Jim_Golden_Beach_Dwelling", "type": "image", "content": "Jim_Golden_Beach_Dwelling.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Dwelling", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:12", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Dwelling.jpg" }, "10520": { "id": 10520, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 258305 }, "label": "Jim_Golden_Beach_Dwellings", "type": "image", "content": "Jim_Golden_Beach_Dwellings.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Dwellings", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:13", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Dwellings.jpg" }, "10521": { "id": 10521, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 257764 }, "label": "Jim_Golden_Beach_Home", "type": "image", "content": "Jim_Golden_Beach_Home.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Home", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:14", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Home.jpg" }, "10522": { "id": 10522, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 228093 }, "label": "Jim_Golden_Beach_House", "type": "image", "content": "Jim_Golden_Beach_House.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach House", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:17", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_House.jpg" }, "10523": { "id": 10523, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 238880 }, "label": "Jim_Golden_Beach_Houses", "type": "image", "content": "Jim_Golden_Beach_Houses.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Houses", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:19", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Houses.jpg" }, "10524": { "id": 10524, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 204842 }, "label": "Jim_Golden_Beach_Landscape", "type": "image", "content": "Jim_Golden_Beach_Landscape.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:20", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Landscape.jpg" }, "10525": { "id": 10525, "size": { "content": { "width": 1140, "height": 835 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 222775 }, "label": "Jim_Golden_Beach_Photos", "type": "image", "content": "Jim_Golden_Beach_Photos.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Photos", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:21", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Photos.jpg" }, "10526": { "id": 10526, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 120846 }, "label": "Jim_Golden_Beach_Sunset", "type": "image", "content": "Jim_Golden_Beach_Sunset.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beach Sunset", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:22", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beach_Sunset.jpg" }, "10527": { "id": 10527, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 166678 }, "label": "Jim_Golden_Beachcombing", "type": "image", "content": "Jim_Golden_Beachcombing.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beachcombing", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:23", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beachcombing.jpg" }, "10528": { "id": 10528, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 264906 }, "label": "Jim_Golden_Beaches", "type": "image", "content": "Jim_Golden_Beaches.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Beaches", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:24", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Beaches.jpg" }, "10529": { "id": 10529, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 156719 }, "label": "Jim_Golden_Cape_Meares_Landscape", "type": "image", "content": "Jim_Golden_Cape_Meares_Landscape.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Cape Meares Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:25", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Cape_Meares_Landscape.jpg" }, "10530": { "id": 10530, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 199962 }, "label": "Jim_Golden_Coast_Docks", "type": "image", "content": "Jim_Golden_Coast_Docks.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coast Docks", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:26", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coast_Docks.jpg" }, "10531": { "id": 10531, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 363219 }, "label": "Jim_Golden_Coast_House", "type": "image", "content": "Jim_Golden_Coast_House.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coast House", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:28", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coast_House.jpg" }, "10532": { "id": 10532, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 290412 }, "label": "Jim_Golden_Coast_Photos", "type": "image", "content": "Jim_Golden_Coast_Photos.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coast Photos", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:29", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coast_Photos.jpg" }, "10533": { "id": 10533, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 130212 }, "label": "Jim_Golden_Coast_Portriats", "type": "image", "content": "Jim_Golden_Coast_Portriats.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coast Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:29", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coast_Portriats.jpg" }, "10534": { "id": 10534, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 274709 }, "label": "Jim_Golden_Coast", "type": "image", "content": "Jim_Golden_Coast.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coast", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:30", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coast.jpg" }, "10535": { "id": 10535, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 341064 }, "label": "Jim_Golden_Coastal_Dwelling", "type": "image", "content": "Jim_Golden_Coastal_Dwelling.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coastal Dwelling", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:31", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coastal_Dwelling.jpg" }, "10536": { "id": 10536, "size": { "content": { "width": 1140, "height": 835 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 192004 }, "label": "Jim_Golden_Coastal_Landscape", "type": "image", "content": "Jim_Golden_Coastal_Landscape.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coastal Landscape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:32", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coastal_Landscape.jpg" }, "10537": { "id": 10537, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 164642 }, "label": "Jim_Golden_Coastal_Photos", "type": "image", "content": "Jim_Golden_Coastal_Photos.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coastal Photos", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:33", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coastal_Photos.jpg" }, "10538": { "id": 10538, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 274381 }, "label": "Jim_Golden_Coastal_Portraits", "type": "image", "content": "Jim_Golden_Coastal_Portraits.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coastal Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:35", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coastal_Portraits.jpg" }, "10539": { "id": 10539, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 131273 }, "label": "Jim_Golden_Coastal_Towns", "type": "image", "content": "Jim_Golden_Coastal_Towns.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coastal Towns", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:36", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coastal_Towns.jpg" }, "10540": { "id": 10540, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 227036 }, "label": "Jim_Golden_Coastal", "type": "image", "content": "Jim_Golden_Coastal.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Coastal", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:37", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Coastal.jpg" }, "10541": { "id": 10541, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 360851 }, "label": "Jim_Golden_Going_Coastal", "type": "image", "content": "Jim_Golden_Going_Coastal.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Going Coastal", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:39", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Going_Coastal.jpg" }, "10542": { "id": 10542, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 234780 }, "label": "Jim_Golden_Haystack_Rock", "type": "image", "content": "Jim_Golden_Haystack_Rock.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Haystack Rock", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:40", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Haystack_Rock.jpg" }, "10543": { "id": 10543, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 213131 }, "label": "Jim_Golden_Landscape_Portraits", "type": "image", "content": "Jim_Golden_Landscape_Portraits.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Landscape Portraits", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:41", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Landscape_Portraits.jpg" }, "10544": { "id": 10544, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181660 }, "label": "Jim_Golden_Manzanita_Oregon", "type": "image", "content": "Jim_Golden_Manzanita_Oregon.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Manzanita Oregon", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:42", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Manzanita_Oregon.jpg" }, "10545": { "id": 10545, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 224738 }, "label": "Jim_Golden_OR_Coast_Dwelling", "type": "image", "content": "Jim_Golden_OR_Coast_Dwelling.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden OR Coast Dwelling", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:42", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_OR_Coast_Dwelling.jpg" }, "10546": { "id": 10546, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 241544 }, "label": "Jim_Golden_OR_Coast", "type": "image", "content": "Jim_Golden_OR_Coast.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden OR Coast", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:43", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_OR_Coast.jpg" }, "10547": { "id": 10547, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 152785 }, "label": "Jim_Golden_Oregon_Beach", "type": "image", "content": "Jim_Golden_Oregon_Beach.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Oregon Beach", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:44", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Oregon_Beach.jpg" }, "10548": { "id": 10548, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 164599 }, "label": "Jim_Golden_Oregon_Beaches", "type": "image", "content": "Jim_Golden_Oregon_Beaches.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Oregon Beaches", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:45", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Oregon_Beaches.jpg", "key": "10548" }, "10549": { "id": 10549, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 137852 }, "label": "Jim_Golden_Oregon_Coast", "type": "image", "content": "Jim_Golden_Oregon_Coast.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Oregon Coast", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:46", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Oregon_Coast.jpg" }, "10550": { "id": 10550, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 130835 }, "label": "Jim_Golden_Pacific_Ocean", "type": "image", "content": "Jim_Golden_Pacific_Ocean.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Pacific Ocean", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:47", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Pacific_Ocean.jpg" }, "10551": { "id": 10551, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 154509 }, "label": "Jim_Golden_Ptarmigan", "type": "image", "content": "Jim_Golden_Ptarmigan.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Ptarmigan", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:50", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_Ptarmigan.jpg" }, "10552": { "id": 10552, "size": { "content": { "width": 1140, "height": 912 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101438 }, "label": "Jim_Golden_The_Cove_Beach", "type": "image", "content": "Jim_Golden_The_Cove_Beach.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden The Cove Beach", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:52", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_The_Cove_Beach.jpg" }, "10553": { "id": 10553, "size": { "content": { "width": 1140, "height": 760 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 109776 }, "label": "Jim_Golden_The_Cove", "type": "image", "content": "Jim_Golden_The_Cove.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden The Cove", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-01 13:11:54", "filters": [ "New Going Coastal" ], "oldFilename": "Jim_Golden_The_Cove.jpg" }, "10554": { "id": 10554, "size": { "content": { "width": 1500, "height": 1000 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 105166 }, "label": "Oregon_Coast_Landscapes", "type": "image", "content": "Oregon_Coast_Landscapes.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon Coast Landscapes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:31", "filters": [ "New Going Coastal" ], "oldFilename": "Oregon_Coast_Landscapes.jpg" }, "10555": { "id": 10555, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 255085 }, "label": "Oregon_Fine_Art_Photography", "type": "image", "content": "Oregon_Fine_Art_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon Fine Art Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:32", "filters": [ "New Going Coastal" ], "oldFilename": "Oregon_Fine_Art_Photography.jpg" }, "10556": { "id": 10556, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 354813 }, "label": "Oregon_FineArt_Photography", "type": "image", "content": "Oregon_FineArt_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon FineArt Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:34", "filters": [ "New Going Coastal" ], "oldFilename": "Oregon_FineArt_Photography.jpg" }, "10557": { "id": 10557, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 275388 }, "label": "Oregon_Landscape_Photography", "type": "image", "content": "Oregon_Landscape_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:34", "filters": [ "New Going Coastal" ], "oldFilename": "Oregon_Landscape_Photography.jpg" }, "10558": { "id": 10558, "size": { "content": { "width": 1500, "height": 1099 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 355984 }, "label": "Oregon_Nature_Photographer", "type": "image", "content": "Oregon_Nature_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "Oregon Nature Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:36", "filters": [ "New Going Coastal" ], "oldFilename": "Oregon_Nature_Photographer.jpg" }, "10559": { "id": 10559, "size": { "content": { "width": 1140, "height": 835 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 272235 }, "label": "PNW_Landscape_Photographer", "type": "image", "content": "PNW_Landscape_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "PNW Landscape Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:37", "filters": [ "New Going Coastal" ], "oldFilename": "PNW_Landscape_Photographer.jpg" }, "10560": { "id": 10560, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 240583 }, "label": "Portland_Fine_Art_Photography", "type": "image", "content": "Portland_Fine_Art_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Fine Art Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:38", "filters": [ "New Going Coastal" ], "oldFilename": "Portland_Fine_Art_Photography.jpg" }, "10561": { "id": 10561, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 211116 }, "label": "Portland_FineArt_Photography", "type": "image", "content": "Portland_FineArt_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland FineArt Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:38", "filters": [ "New Going Coastal" ], "oldFilename": "Portland_FineArt_Photography.jpg" }, "10562": { "id": 10562, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174588 }, "label": "Portland_Landscape_Photographer", "type": "image", "content": "Portland_Landscape_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Landscape Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:41", "filters": [ "New Going Coastal" ], "oldFilename": "Portland_Landscape_Photographer.jpg" }, "10563": { "id": 10563, "size": { "content": { "width": 1200, "height": 1500 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 335000 }, "label": "Portland_Landscape_Photography", "type": "image", "content": "Portland_Landscape_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Landscape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:42", "filters": [ "New Going Coastal" ], "oldFilename": "Portland_Landscape_Photography.jpg" }, "10564": { "id": 10564, "size": { "content": { "width": 1500, "height": 1099 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 118890 }, "label": "Portland_Nature_Photographer", "type": "image", "content": "Portland_Nature_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Nature Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:42", "filters": [ "New Going Coastal" ], "oldFilename": "Portland_Nature_Photographer.jpg" }, "10565": { "id": 10565, "size": { "content": { "width": 1500, "height": 1200 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 362104 }, "label": "West_Coast_Landscape_Photographer", "type": "image", "content": "West_Coast_Landscape_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "West Coast Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-02 15:51:44", "filters": [ "New Going Coastal" ], "oldFilename": "West_Coast_Landscape_Photographer.jpg" }, "10567": { "id": 10567, "size": { "content": { "width": 1557, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 81597 }, "label": "Portland_Dark_Still_Life", "type": "image", "content": "Portland_Dark_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Dark Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-07 18:44:29", "filters": [ "Dark Still Life" ], "oldFilename": "Portland_Dark_Still_Life.jpg" }, "10568": { "id": 10568, "size": { "content": { "width": 1556, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84655 }, "label": "dark photo of an AR-15 rifle", "type": "image", "content": "Dark_Firearms-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "dark photo of an ar-15 assault rifle", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.441Z", "filters": [ "Dark Still Life" ], "oldFilename": "Dark_Firearms-copy1.jpg", "postDate": "2022-04-18T18:56:38.705Z", "key": "10568", "keywords": [ "gun", "assault rifle", "ar-15", "dark", "moody", "weapon", "still life", "photo", "conceptual" ], "searchable": true }, "10570": { "id": 10570, "size": { "content": { "width": 1187, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101612 }, "label": "patrick bateman office still life brick phone ", "type": "image", "content": "Office_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Office Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.641Z", "filters": [ "Archive" ], "oldFilename": "Office_Still_Life.jpg", "key": "10570" }, "10571": { "id": 10571, "size": { "content": { "width": 924, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 78814 }, "label": "saturday afternoon reading on a lake dock smoking a cigar", "type": "image", "content": "Portland_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.641Z", "filters": [ "Archive" ], "oldFilename": "Portland_Still_Life.jpg", "key": "10571" }, "10572": { "id": 10572, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 167229 }, "label": "80s travel agents desk with tropical wallpaper", "type": "image", "content": "Still_Life_Set_Design.jpg", "thumb": "", "linkTarget": "", "caption": "Still Life Set Design", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.641Z", "filters": [ "Archive" ], "oldFilename": "Still_Life_Set_Design.jpg", "key": "10572" }, "10573": { "id": 10573, "size": { "content": { "width": 1538, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 188564 }, "label": "Vintage_Vignette_Photography", "type": "image", "content": "Vintage_Vignette_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Vintage Vignette Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08 10:54:15", "filters": [ "Archive" ], "oldFilename": "Vintage_Vignette_Photography.jpg", "key": "10573" }, "10574": { "id": 10574, "size": { "content": { "width": 1083, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198528 }, "label": "Levi Nike Apparel Laydown", "type": "image", "content": "LeviNikeApparelLaydown.jpg", "thumb": "", "linkTarget": "", "caption": "Levi Nike Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08 10:59:07", "filters": [ "Apparel" ], "oldFilename": "Levi Nike Apparel Laydown.jpg" }, "10575": { "id": 10575, "size": { "content": { "width": 1551, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 122855 }, "label": "Sporting Apparel Laydown", "type": "image", "content": "SportingApparelLaydown.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:00:32.000Z", "filters": [], "oldFilename": "Sporting Apparel Laydown.jpg" }, "10576": { "id": 10576, "size": { "content": { "width": 1551, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 122855 }, "label": "Sporting_Apparel_Laydown", "type": "image", "content": "Sporting_Apparel_Laydown-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Sporting Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08 11:01:04", "filters": [ "Apparel" ], "oldFilename": "Sporting_Apparel_Laydown-copy1.jpg", "postDate": "2019-02-06T22:11:50.246Z" }, "10577": { "id": 10577, "size": { "content": { "width": 1440, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 66185 }, "label": "Relics_of_Technology_8_inch_Floppy", "type": "image", "content": "Relics_of_Technology_8_inch_Floppy.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology 8 inch Floppy", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:08:16.000Z", "filters": [], "oldFilename": "Relics_of_Technology_8_inch_Floppy.jpg" }, "10578": { "id": 10578, "size": { "content": { "width": 858, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 22708 }, "label": "Relics_of_Technology_Atari_Joystick", "type": "image", "content": "Relics_of_Technology_Atari_Joystick.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Atari Joystick", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:08:16.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Atari_Joystick.jpg" }, "10579": { "id": 10579, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 203180 }, "label": "Relics_of_Technology_Cassettes", "type": "image", "content": "Relics_of_Technology_Cassettes.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Cassettes", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:08:17.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Cassettes.jpg" }, "10580": { "id": 10580, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 179714 }, "label": "Relics_of_Technology_Floppy_Disc", "type": "image", "content": "Relics_of_Technology_Floppy_Disc.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Floppy Disc", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:08:18.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Floppy_Disc.jpg" }, "10581": { "id": 10581, "size": { "content": { "width": 1566, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 79810 }, "label": "Relics_of_Technology_Microcassette", "type": "image", "content": "Relics_of_Technology_Microcassette.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:08:19.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Microcassette.jpg" }, "10582": { "id": 10582, "size": { "content": { "width": 1418, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84963 }, "label": "Relics_of_Technology_ROM", "type": "image", "content": "Relics_of_Technology_ROM.jpg", "thumb": "", "linkTarget": "", "caption": "Relics of Technology ROM", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:08:19.000Z", "filters": [], "oldFilename": "Relics_of_Technology_ROM.jpg" }, "10583": { "id": 10583, "size": { "content": { "width": 1440, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 66185 }, "label": "5 1/4 inch floppy disk arranged neatly", "type": "image", "content": "Relics_of_Technology_8_inch_Floppy-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "8\" Type 1 Diskette", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_8_inch_Floppy-copy1.jpg" }, "10584": { "id": 10584, "size": { "content": { "width": 858, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 22708 }, "label": "atari joystick on a tan background", "type": "image", "content": "Relics_of_Technology_Atari_Joystick-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Atari Joystick", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Atari_Joystick-copy1.jpg" }, "10585": { "id": 10585, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 203180 }, "label": "Relics_of_Technology_Cassettes", "type": "image", "content": "Relics_of_Technology_Cassettes-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Cassette Tape", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08 11:10:46", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Cassettes-copy1.jpg" }, "10586": { "id": 10586, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 179714 }, "label": "8 inch floppy diskette on blue paper", "type": "image", "content": "Relics_of_Technology_Floppy_Disc-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "8\" Diskette", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Floppy_Disc-copy1.jpg" }, "10587": { "id": 10587, "size": { "content": { "width": 1566, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 79810 }, "label": "micro cassette tapes from answering machines", "type": "image", "content": "Relics_of_Technology_Microcassette-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Microcassette", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.995Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Microcassette-copy1.jpg" }, "10588": { "id": 10588, "size": { "content": { "width": 1418, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84963 }, "label": "ROM cartridges in a space invaders pattern", "type": "image", "content": "Relics_of_Technology_ROM-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "ROM Cartridge", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_ROM-copy1.jpg" }, "10589": { "id": 10589, "size": { "content": { "width": 1932, "height": 1491 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2833817 }, "label": "animated GIF of a reel to reel tape machine, relic", "type": "image", "content": "Relics_of_Technology_Reel_to_Reel-copy1.gif", "thumb": "", "linkTarget": "", "caption": "Reel-to-Reel", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ] }, "10590": { "id": 10590, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1353801 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter-copy2.gif", "thumb": "", "linkTarget": "", "caption": "Relics of Technology Typewriter", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-08T18:29:11.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter-copy2.gif" }, "10591": { "id": 10591, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "[instagram]", "type": "link", "content": "http://instagram.com/jimgolden#", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T22:35:22.532Z", "filters": [ "Footer Links" ], "key": "10591" }, "10592": { "id": 10592, "size": { "content": { "width": 1298, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 175967 }, "label": "levis denim jackets an old american flag", "type": "image", "content": "Denim_Apparel_Photography-copy3.jpg", "thumb": "", "linkTarget": "", "caption": "Denim Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:45.872Z", "filters": [ "Apparel" ], "postDate": "2020-05-04T22:37:53.443Z" }, "10593": { "id": 10593, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 59682 }, "label": "Athleticwear_Photography", "type": "image", "content": "Athleticwear_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Athleticwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-10T23:09:27.000Z", "filters": [], "oldFilename": "Athleticwear_Photography-copy1.jpg" }, "10594": { "id": 10594, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 142620 }, "label": "Soft_Gear_Photography", "type": "image", "content": "Soft_Gear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Soft Gear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-10T23:09:28.000Z", "filters": [], "oldFilename": "Soft_Gear_Photography.jpg" }, "10595": { "id": 10595, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 60471 }, "label": "Sports_Apparel_Photography", "type": "image", "content": "Sports_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Sports Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-10T23:09:28.000Z", "filters": [], "oldFilename": "Sports_Apparel_Photography.jpg" }, "10596": { "id": 10596, "size": { "content": { "width": 2703, "height": 2015 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4712267 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter-copy3.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-14T21:01:41.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter-copy3.gif" }, "10597": { "id": 10597, "size": { "content": { "width": 2703, "height": 2015 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4712267 }, "label": "Relics_of_Technology_Typewriter", "type": "image", "content": "Relics_of_Technology_Typewriter-copy4.gif", "thumb": "", "linkTarget": "", "caption": "Relics of Technology, Typewriter", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-14T21:01:42.000Z", "filters": [], "oldFilename": "Relics_of_Technology_Typewriter-copy4.gif" }, "10598": { "id": 10598, "size": { "content": { "width": 1140, "height": 1520 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 251500 }, "label": "Relics_of_Technology_Viewmaster", "type": "image", "content": "Relics_of_Technology_Viewmaster-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "View-Master", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-14 14:04:47", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Viewmaster-copy1.jpg" }, "10601": { "id": 10601, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 293793 }, "label": "Sportswear_DriFit_Nike", "type": "image", "content": "Sportswear_DriFit_Nike.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-16T20:31:53.000Z", "filters": [], "oldFilename": "Sportswear_DriFit_Nike.jpg" }, "10602": { "id": 10602, "size": { "content": { "width": 1714, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 315724 }, "label": "Sportswear_Nike_Soccer", "type": "image", "content": "Sportswear_Nike_Soccer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-16T20:47:09.000Z", "filters": [], "oldFilename": "Sportswear_Nike_Soccer.jpg" }, "10603": { "id": 10603, "size": { "content": { "width": 1797, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 407971 }, "label": "Sportswear_Nike_Soccer-2", "type": "image", "content": "Sportswear_Nike_Soccer-2.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-16T20:47:10.000Z", "filters": [], "oldFilename": "Sportswear_Nike_Soccer-2.jpg" }, "10604": { "id": 10604, "size": { "content": { "width": 2703, "height": 2015 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4521504 }, "label": "vintage analog typewriter on a green background", "type": "image", "content": "Relics_of_Technology_Typewriter-copy5.gif", "thumb": "", "linkTarget": "", "caption": "Typewriter", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.994Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics_of_Technology_Typewriter-copy5.gif" }, "10605": { "id": 10605, "size": { "content": { "width": 1672, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106196 }, "label": "moody 80s boombox photo", "type": "image", "content": "Boombox_Still_Life_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Boombox Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.440Z", "filters": [ "Dark Still Life" ], "oldFilename": "Boombox_Still_Life_Photography.jpg", "postDate": "2022-04-18T18:56:38.705Z" }, "10606": { "id": 10606, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 201500 }, "label": "vintage barrette collection organized in a rainbow ", "type": "image", "content": "Barrette_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.448Z", "filters": [ "Collections" ], "oldFilename": "Barrette_Collection.jpg", "key": "10606", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "barrette", "gradient" ], "searchable": true }, "10607": { "id": 10607, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 296941 }, "label": "Typewriter_Pattern", "type": "image", "content": "Typewriter_Pattern.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-17T23:37:38.000Z", "filters": [], "oldFilename": "Typewriter_Pattern.jpg" }, "10608": { "id": 10608, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 296941 }, "label": "vintage typewriters arranged neatly from overhead", "type": "image", "content": "Typewriter_Pattern-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Typewriter Pattern", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Patterns", "Collections" ], "oldFilename": "Typewriter_Pattern-copy1.jpg", "key": "10608", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "typewriters" ], "searchable": true }, "10609": { "id": 10609, "size": { "content": { "width": 1140, "height": 848 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 96935 }, "label": "Relics of Technology Portland", "type": "image", "content": "RelicsofTechnologyPortland.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-23T21:16:13.000Z", "filters": [], "oldFilename": "Relics of Technology Portland.jpg" }, "10610": { "id": 10610, "size": { "content": { "width": 1140, "height": 848 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 96935 }, "label": "Relics of Technology Portland", "type": "image", "content": "RelicsofTechnologyPortland-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2014-04-23T21:16:25.000Z", "filters": [], "oldFilename": "Relics of Technology Portland-copy1.jpg" }, "10611": { "id": 10611, "size": { "content": { "width": 1140, "height": 848 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 96848 }, "label": "Relics of Technology artist statement", "type": "image", "content": "RelicsofTechnology.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:44.996Z", "filters": [ "Relics of Technology" ], "oldFilename": "Relics of Technology.jpg" }, "10613": { "id": 10613, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 229492 }, "label": "Sewing_Machine_Still_Life", "type": "image", "content": "Sewing_Machine_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Sewing Machine Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-07-22 12:58:53", "filters": [ "Still Life" ], "oldFilename": "Sewing_Machine_Still_Life.jpg" }, "10614": { "id": 10614, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 176529 }, "label": "Fruit_Blender_Still_Life", "type": "image", "content": "Fruit_Blender_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Fruit Blender Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-07-22T19:58:58.000Z", "filters": [], "oldFilename": "Fruit_Blender_Still_Life.jpg" }, "10615": { "id": 10615, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 122369 }, "label": "Flower_Watering_Can_Still_Life", "type": "image", "content": "Flower_Watering_Can_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Flower Watering Can Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-07-22 12:59:03", "filters": [ "Still Life" ], "oldFilename": "Flower_Watering_Can_Still_Life.jpg" }, "10616": { "id": 10616, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 250136 }, "label": "Flower_Wheel_Barrow_Still_Life", "type": "image", "content": "Flower_Wheel_Barrow_Still_Life.jpg", "thumb": "", "linkTarget": "", "caption": "Flower Wheel Barrow Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-07-22 12:59:07", "filters": [ "Still Life" ], "oldFilename": "Flower_Wheel_Barrow_Still_Life.jpg" }, "10617": { "id": 10617, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178098 }, "label": "Fruit_Blender_Still_Life", "type": "image", "content": "Fruit_Blender_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Fruit Blender Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2014-07-22T20:26:42.000Z", "filters": [], "oldFilename": "Fruit_Blender_Still_Life-copy1.jpg" }, "10618": { "id": 10618, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178098 }, "label": "fruit for a smoothie in a blender shape ", "type": "image", "content": "Fruit_Blender_Still_Life-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Fruit Blender Still Life", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-07T20:12:18.097Z", "filters": [ "Still Life", "Food" ], "oldFilename": "Fruit_Blender_Still_Life-copy2.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10618" }, "10619": { "id": 10619, "size": { "content": { "width": 1341, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 142452 }, "label": "collection of sewing stuff in shape of a sewing machine", "type": "image", "content": "Sewing_Machine_Still_Life-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Sewing Machine Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.168Z", "filters": [ "Still Life" ], "oldFilename": "Sewing_Machine_Still_Life-copy1.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10619" }, "10620": { "id": 10620, "size": { "content": { "width": 897, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 115959 }, "label": "Cleaning_Products_Jim_Golden", "type": "image", "content": "Cleaning_Products_Jim_Golden.jpg", "thumb": "", "linkTarget": "", "caption": "Cleaning Products", "overrides": {}, "featuredImage": "", "dateAdded": "2015-01-29T01:54:26.000Z", "filters": [], "oldFilename": "Cleaning_Products_Jim_Golden.jpg" }, "10621": { "id": 10621, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 220895 }, "label": "vintage thermos collection on a green background", "type": "image", "content": "Thermos_Collection.jpg", "thumb": "", "linkTarget": "", "caption": "Thermos Collection", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:23:37.447Z", "filters": [ "Collections", "Recent", "removed from overview" ], "oldFilename": "Thermos_Collection.jpg", "key": "10621", "keywords": [ "knolling", "layflat", "topdown", "things organized neatly", "still life", "objects", "jim golden", "thermos" ], "searchable": true }, "10622": { "id": 10622, "size": { "content": { "width": 1169, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 256786 }, "label": "adidas_Apparel_Laydown", "type": "image", "content": "adidas_Apparel_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "adidas Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 17:41:29", "filters": [ "Apparel" ], "oldFilename": "adidas_Apparel_Laydown.jpg" }, "10623": { "id": 10623, "size": { "content": { "width": 1069, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 344310 }, "label": "Audubon_Mag_Laydown", "type": "image", "content": "Audubon_Mag_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Audubon Mag Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T00:41:31.000Z", "filters": [], "oldFilename": "Audubon_Mag_Laydown.jpg" }, "10624": { "id": 10624, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193666 }, "label": "Audubon_Magazine_Laydown", "type": "image", "content": "Audubon_Magazine_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Audubon Magazine Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T00:41:31.000Z", "filters": [], "oldFilename": "Audubon_Magazine_Laydown.jpg" }, "10625": { "id": 10625, "size": { "content": { "width": 1858, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 358985 }, "label": "nike kevin durant basketball apparel on a wood backgorund", "type": "image", "content": "Basketball_Apparel_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Basketball Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:45.872Z", "filters": [ "Apparel" ] }, "10626": { "id": 10626, "size": { "content": { "width": 1676, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 253493 }, "label": "Hare_Jordan_Jim_Golden", "type": "image", "content": "Hare_Jordan_Jim_Golden.jpg", "thumb": "", "linkTarget": "", "caption": "Hare Jordan Jim Golden", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 17:41:33", "filters": [ "Apparel", "Recent" ], "oldFilename": "Hare_Jordan_Jim_Golden.jpg", "postDate": "2019-02-06T22:08:22.354Z" }, "10627": { "id": 10627, "size": { "content": { "width": 2837, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 448015 }, "label": "assortment of colorful adidas hats", "type": "image", "content": "Jim_Golden_adidas_Caps.jpg", "thumb": "", "linkTarget": "", "caption": "Adidas Caps Still Life", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:34:41.081Z", "filters": [ "Apparel" ], "oldFilename": "Jim_Golden_adidas_Caps.jpg", "postDate": "2020-05-04T22:37:59.343Z" }, "10628": { "id": 10628, "size": { "content": { "width": 2114, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 334182 }, "label": "adidas originals jackets shirts and sneakers rainbow", "type": "image", "content": "Jim_Golden_adidas_Eastbay.jpg", "thumb": "", "linkTarget": "", "caption": "Eastbay Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.643Z", "filters": [ "Apparel" ], "oldFilename": "Jim_Golden_adidas_Eastbay.jpg", "postDate": "2019-02-06T22:11:21.337Z", "key": "10628" }, "10629": { "id": 10629, "size": { "content": { "width": 2837, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 410996 }, "label": "Jim_Golden_adidas_Tees", "type": "image", "content": "Jim_Golden_adidas_Tees.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden adidas Tees", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 17:41:37", "filters": [ "Apparel" ], "oldFilename": "Jim_Golden_adidas_Tees.jpg" }, "10630": { "id": 10630, "size": { "content": { "width": 2121, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 182210 }, "label": "Jim_Golden_Studio_Jerseys", "type": "image", "content": "Jim_Golden_Studio_Jerseys.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Studio Jerseys", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 17:41:38", "filters": [ "Apparel" ], "oldFilename": "Jim_Golden_Studio_Jerseys.jpg", "postDate": "2019-02-06T22:09:56.318Z" }, "10631": { "id": 10631, "size": { "content": { "width": 1258, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 129306 }, "label": "brand jordan holiday apparel organized neatly", "type": "image", "content": "Jordan_Jim_Golden_Studio.jpg", "thumb": "", "linkTarget": "", "caption": "Jordan Jim Golden Studio", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-26T22:42:45.871Z", "filters": [ "Apparel", "Recent", "removed from overview" ], "oldFilename": "Jordan_Jim_Golden_Studio.jpg", "postDate": "2020-05-04T22:37:45.807Z" }, "10632": { "id": 10632, "size": { "content": { "width": 887, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 93610 }, "label": "Puffer_Jacket_Photography", "type": "image", "content": "Puffer_Jacket_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Puffer Jacket Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 17:41:38", "filters": [ "Apparel" ], "oldFilename": "Puffer_Jacket_Photography.jpg" }, "10633": { "id": 10633, "size": { "content": { "width": 1675, "height": 757 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 396293 }, "label": "summer nike apparel for kids", "type": "image", "content": "Summer_Athleticwear_Laydown-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Summer Athleticwear Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:34:41.081Z", "filters": [ "Apparel" ], "oldFilename": "Summer_Athleticwear_Laydown-copy1.jpg", "postDate": "2020-05-04T22:37:59.343Z" }, "10634": { "id": 10634, "size": { "content": { "width": 2314, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 294324 }, "label": "Soccer_Apparel_Laydown", "type": "image", "content": "Soccer_Apparel_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Soccer Apparel Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 18:02:31", "filters": [ "Apparel" ], "oldFilename": "Soccer_Apparel_Laydown.jpg" }, "10635": { "id": 10635, "size": { "content": { "width": 1499, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269112 }, "label": "Basketball_Apparel_Photography", "type": "image", "content": "Basketball_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Basketball Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-02 18:10:47", "filters": [ "Apparel", "Recent" ], "oldFilename": "Basketball_Apparel_Photography.jpg" }, "10636": { "id": 10636, "size": { "content": { "width": 1102, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 190647 }, "label": "Audubon_Gear_Laydown", "type": "image", "content": "Audubon_Gear_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Audubon Gear Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:15:06", "filters": [ "Apparel" ], "oldFilename": "Audubon_Gear_Laydown.jpg" }, "10637": { "id": 10637, "size": { "content": { "width": 1176, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 238932 }, "label": "Birding_Gear_Photography", "type": "image", "content": "Birding_Gear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Birding Gear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:15:10", "filters": [ "Apparel" ], "oldFilename": "Birding_Gear_Photography.jpg" }, "10638": { "id": 10638, "size": { "content": { "width": 1962, "height": 1472 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 215725 }, "label": "Cactus_Photography", "type": "image", "content": "Cactus_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Cactus Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T18:33:53.000Z", "filters": [], "oldFilename": "Cactus_Photography.jpg" }, "10639": { "id": 10639, "size": { "content": { "width": 1962, "height": 1472 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 296025 }, "label": "Dark_Photography", "type": "image", "content": "Dark_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T18:33:54.000Z", "filters": [], "oldFilename": "Dark_Photography.jpg" }, "10640": { "id": 10640, "size": { "content": { "width": 1472, "height": 1962 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 372414 }, "label": "Dramatic_Lighting_Photography", "type": "image", "content": "Dramatic_Lighting_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Dramatic Lighting Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T18:33:55.000Z", "filters": [], "oldFilename": "Dramatic_Lighting_Photography.jpg" }, "10641": { "id": 10641, "size": { "content": { "width": 1567, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 94603 }, "label": "Firearm_Photography_Portland", "type": "image", "content": "Firearm_Photography_Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Firearm Photography Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:33:55", "filters": [ "Dark Still Life" ], "oldFilename": "Firearm_Photography_Portland.jpg" }, "10642": { "id": 10642, "size": { "content": { "width": 1962, "height": 1472 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 207092 }, "label": "Living_Photography", "type": "image", "content": "Living_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Living Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T18:33:56.000Z", "filters": [], "oldFilename": "Living_Photography.jpg" }, "10643": { "id": 10643, "size": { "content": { "width": 1472, "height": 1962 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 306759 }, "label": "Plant_Photography", "type": "image", "content": "Plant_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Plant Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T18:33:57.000Z", "filters": [], "oldFilename": "Plant_Photography.jpg" }, "10644": { "id": 10644, "size": { "content": { "width": 1962, "height": 1472 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 248313 }, "label": "Succulent_Photography", "type": "image", "content": "Succulent_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Succulent Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T18:33:58.000Z", "filters": [], "oldFilename": "Succulent_Photography.jpg" }, "10645": { "id": 10645, "size": { "content": { "width": 1501, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 513731 }, "label": "grilled chicken and shredded cabbage on orange placemat", "type": "image", "content": "Asian_Food_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Asian Food Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.762Z", "filters": [ "Food", "Recent" ], "oldFilename": "Asian_Food_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10645" }, "10646": { "id": 10646, "size": { "content": { "width": 1541, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 206908 }, "label": "cake on moving boxes treat for working hard", "type": "image", "content": "Birthday_Cake_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Birthday Cake Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food" ], "oldFilename": "Birthday_Cake_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10646" }, "10647": { "id": 10647, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 363428 }, "label": "Cake_Happens", "type": "image", "content": "Cake_Happens.jpg", "thumb": "", "linkTarget": "", "caption": "Cake Happens", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:50:07", "filters": [ "Food" ], "oldFilename": "Cake_Happens.jpg" }, "10648": { "id": 10648, "size": { "content": { "width": 1605, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 485433 }, "label": "chocolate cake at a family picnic", "type": "image", "content": "Cake_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Cake Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food" ], "oldFilename": "Cake_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10648" }, "10649": { "id": 10649, "size": { "content": { "width": 1558, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 541198 }, "label": "grilled pork starry on white rice", "type": "image", "content": "Food_Photographer_Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Food Photographer Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.763Z", "filters": [ "Food", "Recent" ], "oldFilename": "Food_Photographer_Portland.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10649" }, "10650": { "id": 10650, "size": { "content": { "width": 1516, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 576793 }, "label": "grilled kabobs on a green plate", "type": "image", "content": "Food_Photography_Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Food Photography Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.762Z", "filters": [ "Food", "Recent" ], "oldFilename": "Food_Photography_Portland.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10650" }, "10651": { "id": 10651, "size": { "content": { "width": 1400, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 321635 }, "label": "udon noodles with grilled drumsticks", "type": "image", "content": "Food_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Food Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.763Z", "filters": [ "Food", "Recent" ], "oldFilename": "Food_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10651" }, "10652": { "id": 10652, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 231953 }, "label": "Food_Shape_Photography", "type": "image", "content": "Food_Shape_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Food Shape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:50:30", "filters": [ "Food" ], "oldFilename": "Food_Shape_Photography.jpg", "postDate": "2020-05-04T22:45:32.539Z" }, "10653": { "id": 10653, "size": { "content": { "width": 1535, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 504046 }, "label": "asian slaw with red peppers on mustard yellow placemat ", "type": "image", "content": "Food_Styling.jpg", "thumb": "", "linkTarget": "", "caption": "Food Styling", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.763Z", "filters": [ "Food", "Recent" ], "oldFilename": "Food_Styling.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10653", "searchable": true }, "10654": { "id": 10654, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 235697 }, "label": "ravioli goat cheese and arugula in the shape of a plate", "type": "image", "content": "Shape_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Shape Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.322Z", "filters": [ "Food" ], "oldFilename": "Shape_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10654" }, "10655": { "id": 10655, "size": { "content": { "width": 1396, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 589041 }, "label": "Steak_Photography", "type": "image", "content": "Steak_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Steak Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:50:33", "filters": [ "Food", "Recent" ], "oldFilename": "Steak_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z" }, "10656": { "id": 10656, "size": { "content": { "width": 1577, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 212288 }, "label": "slice of white cake at a diner", "type": "image", "content": "Weight_Watchers_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Weight Watchers Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food" ], "oldFilename": "Weight_Watchers_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10656" }, "10657": { "id": 10657, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 283736 }, "label": "tacos and tortilla chips with a beer mexican food", "type": "image", "content": "Mexican_Food_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Mexican Food Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.322Z", "filters": [ "Food", "Recent", "removed from overview" ], "oldFilename": "Mexican_Food_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10657" }, "10658": { "id": 10658, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 164745 }, "label": "Portland_Food_Photography", "type": "image", "content": "Portland_Food_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Food Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 11:59:21", "filters": [ "Food", "Recent", "removed from overview" ], "oldFilename": "Portland_Food_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z" }, "10659": { "id": 10659, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101442 }, "label": "Footwear_Photography_Portland", "type": "image", "content": "Footwear_Photography_Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Footwear Photography Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:12:30", "filters": [ "Footwear" ], "oldFilename": "Footwear_Photography_Portland.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10660": { "id": 10660, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193528 }, "label": "Footwear_Portland_Photography", "type": "image", "content": "Footwear_Portland_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Footwear Portland Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T19:12:31.000Z", "filters": [], "oldFilename": "Footwear_Portland_Photography.jpg" }, "10661": { "id": 10661, "size": { "content": { "width": 1413, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 141359 }, "label": "Jordan_Photography_Portland", "type": "image", "content": "Jordan_Photography_Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Jordan Photography Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:12:32", "filters": [ "Footwear" ], "oldFilename": "Jordan_Photography_Portland.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10662": { "id": 10662, "size": { "content": { "width": 2427, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 362133 }, "label": "adidas superstar rainbow sneaker pharrell williams", "type": "image", "content": "Rainbow_Shoe_Photo.jpg", "thumb": "", "linkTarget": "", "caption": "Rainbow Shoe Photo", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.643Z", "filters": [ "Footwear" ], "oldFilename": "Rainbow_Shoe_Photo.jpg", "postDate": "2019-02-06T22:15:44.983Z", "key": "10662" }, "10663": { "id": 10663, "size": { "content": { "width": 985, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 274548 }, "label": "Colorful_Footwear_Photography", "type": "image", "content": "Reebok_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Colorful Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:12:34", "filters": [ "Footwear" ], "oldFilename": "Reebok_Footwear_Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10664": { "id": 10664, "size": { "content": { "width": 797, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 159878 }, "label": "Reebok_Photography", "type": "image", "content": "Reebok_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Reebok Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T19:12:35.000Z", "filters": [], "oldFilename": "Reebok_Photography.jpg" }, "10665": { "id": 10665, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 518625 }, "label": "Shoe_Detail_Photography", "type": "image", "content": "Shoe_Detail_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Shoe Detail Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:12:36", "filters": [ "Footwear" ], "oldFilename": "Shoe_Detail_Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10666": { "id": 10666, "size": { "content": { "width": 1438, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186640 }, "label": "Sneaker_Photography", "type": "image", "content": "Sneaker_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Sneaker Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:12:36", "filters": [ "Footwear" ], "oldFilename": "Sneaker_Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10667": { "id": 10667, "size": { "content": { "width": 1605, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 188351 }, "label": "Urban_Shoe_Photography", "type": "image", "content": "Urban_Shoe_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Urban Shoe Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:12:38", "filters": [ "Footwear", "Recent" ], "oldFilename": "Urban_Shoe_Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10668": { "id": 10668, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 225488 }, "label": "Footwear_Detail_Photography", "type": "image", "content": "Footwear_Detail_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Footwear Detail Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T19:20:38.000Z", "filters": [], "oldFilename": "Footwear_Detail_Photography.jpg" }, "10669": { "id": 10669, "size": { "content": { "width": 1564, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181017 }, "label": "Vibrant_Footwear_Photography", "type": "image", "content": "Vibrant_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Vibrant Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T19:23:06.000Z", "filters": [], "oldFilename": "Vibrant_Footwear_Photography.jpg" }, "10670": { "id": 10670, "size": { "content": { "width": 1564, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181017 }, "label": "Vibrant_Footwear_Photography", "type": "image", "content": "Vibrant_Footwear_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Vibrant Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:23:57", "filters": [ "Footwear" ], "oldFilename": "Vibrant_Footwear_Photography-copy1.jpg" }, "10671": { "id": 10671, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 152326 }, "label": "Portland_Footwear_Photography", "type": "image", "content": "Portland_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:28:43", "filters": [ "Footwear" ], "oldFilename": "Portland_Footwear_Photography.jpg" }, "10672": { "id": 10672, "size": { "content": { "width": 1542, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 184391 }, "label": "white and grey sportswear collection", "type": "image", "content": "Light_Nike_Sporting_Apparel-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Light Sporting Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:34:41.081Z", "filters": [ "Apparel" ], "oldFilename": "Light_Nike_Sporting_Apparel-copy1.jpg", "postDate": "2020-05-04T22:37:59.343Z" }, "10673": { "id": 10673, "size": { "content": { "width": 950, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186357 }, "label": "Editorial_Laydown_Photography", "type": "image", "content": "Editorial_Laydown_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Editorial Laydown Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:50:23", "filters": [ "Still Life", "Recent" ], "oldFilename": "Editorial_Laydown_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10674": { "id": 10674, "size": { "content": { "width": 927, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 134499 }, "label": "Firearm_Still_Life_Photography", "type": "image", "content": "Firearm_Still_Life_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Firearm Still Life Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:50:24", "filters": [ "Still Life" ], "oldFilename": "Firearm_Still_Life_Photography.jpg", "postDate": "2019-02-06T19:31:01.686Z" }, "10675": { "id": 10675, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 189970 }, "label": "fork spoon knife flatware in a pattern", "type": "image", "content": "Houseware_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Houseware Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life", "Recent", "removed from overview" ], "oldFilename": "Houseware_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10675" }, "10676": { "id": 10676, "size": { "content": { "width": 879, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178649 }, "label": "Leatherman_Photography", "type": "image", "content": "Leatherman_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Leatherman Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:50:25", "filters": [ "Still Life" ], "oldFilename": "Leatherman_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10677": { "id": 10677, "size": { "content": { "width": 2789, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 298238 }, "label": "giant nike swoosh made out of nike football cleats", "type": "image", "content": "Nike_Swoosh_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Swoosh Photography", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-12T17:51:15.616Z", "filters": [ "Still Life" ] }, "10678": { "id": 10678, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 121724 }, "label": "Pocket_Tool_Photography", "type": "image", "content": "Pocket_Tool_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Pocket Tool Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:50:28", "filters": [ "Still Life" ], "oldFilename": "Pocket_Tool_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10679": { "id": 10679, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150884 }, "label": "flatware pattern of butter knives", "type": "image", "content": "Serveware_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Serveware Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.169Z", "filters": [ "Still Life" ], "oldFilename": "Serveware_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10679" }, "10680": { "id": 10680, "size": { "content": { "width": 883, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 146474 }, "label": "Surfrider_Foundation_Photography", "type": "image", "content": "Surfrider_Foundation_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Surfrider Foundation Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:50:29", "filters": [ "Still Life" ], "oldFilename": "Surfrider_Foundation_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10681": { "id": 10681, "size": { "content": { "width": 1353, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 245061 }, "label": "Tech_Laydown_Photgraphy", "type": "image", "content": "Tech_Laydown_Photgraphy.jpg", "thumb": "", "linkTarget": "", "caption": "Tech Laydown Photgraphy", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:50:30", "filters": [ "Still Life" ], "oldFilename": "Tech_Laydown_Photgraphy.jpg", "postDate": "2020-05-04T22:53:46.381Z", "key": "10681" }, "10682": { "id": 10682, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 88555 }, "label": "Firearm_Photography", "type": "image", "content": "Firearm_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Firearm Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 12:55:51", "filters": [ "Still Life" ], "oldFilename": "Firearm_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10683": { "id": 10683, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 119043 }, "label": "Graphic_Food_Photography", "type": "image", "content": "Graphic_Food_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Graphic Food Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 13:00:31", "filters": [ "Recent" ], "oldFilename": "Graphic_Food_Photography.jpg" }, "10684": { "id": 10684, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 116430 }, "label": "iFood_Photography", "type": "image", "content": "iFood_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "iFood Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 13:00:32", "filters": [ "Recent" ], "oldFilename": "iFood_Photography.jpg" }, "10685": { "id": 10685, "size": { "content": { "width": 1462, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 234068 }, "label": "vegetables in clear glass cylinders on white", "type": "image", "content": "Vegetable_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Vegetable Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food", "Recent" ], "oldFilename": "Vegetable_Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10685" }, "10686": { "id": 10686, "size": { "content": { "width": 1185, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 62107 }, "label": "Hand_Gun_Photography", "type": "image", "content": "Hand_Gun_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Hand Gun Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 13:08:08", "filters": [ "Dark Still Life" ], "oldFilename": "Hand_Gun_Photography.jpg" }, "10687": { "id": 10687, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 706937 }, "label": "Floral_Dark_Photography", "type": "image", "content": "Floral_Dark_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Floral Dark Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 13:12:01", "filters": [ "Dark Still Life" ], "oldFilename": "Floral_Dark_Photography.jpg" }, "10688": { "id": 10688, "size": { "content": { "width": 897, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 116237 }, "label": "Cleaning_Products_Jim_Golden", "type": "image", "content": "Cleaning_Products_Jim_Golden-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Cleaning Products Jim Golden", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 15:39:05", "filters": [ "Still Life" ], "oldFilename": "Cleaning_Products_Jim_Golden-copy1.jpg", "postDate": "2020-05-04T22:50:47.904Z" }, "10689": { "id": 10689, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 103265 }, "label": "Cactus_Photography", "type": "image", "content": "Cactus_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Cactus Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T23:34:50.000Z", "filters": [], "oldFilename": "Cactus_Photography-copy1.jpg" }, "10690": { "id": 10690, "size": { "content": { "width": 1444, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101718 }, "label": "Dark_Photography", "type": "image", "content": "Dark_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T23:34:53.000Z", "filters": [], "oldFilename": "Dark_Photography-copy1.jpg" }, "10691": { "id": 10691, "size": { "content": { "width": 1048, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 143834 }, "label": "Dramatic_Lighting_Photography", "type": "image", "content": "Dramatic_Lighting_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Dramatic Lighting Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T23:34:58.000Z", "filters": [], "oldFilename": "Dramatic_Lighting_Photography-copy1.jpg" }, "10692": { "id": 10692, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 55637 }, "label": "Living_Photography", "type": "image", "content": "Living_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Living Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T23:35:01.000Z", "filters": [], "oldFilename": "Living_Photography-copy1.jpg" }, "10693": { "id": 10693, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 103265 }, "label": "Cactus_Photography", "type": "image", "content": "Cactus_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Cactus Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 16:37:41", "filters": [ "Dark Still Life" ], "oldFilename": "Cactus_Photography-copy2.jpg" }, "10694": { "id": 10694, "size": { "content": { "width": 1444, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101718 }, "label": "Dark_Photography", "type": "image", "content": "Dark_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Dark Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 16:37:42", "filters": [ "Dark Still Life" ], "oldFilename": "Dark_Photography-copy2.jpg", "postDate": "2019-02-07T23:35:53.410Z" }, "10695": { "id": 10695, "size": { "content": { "width": 1048, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 143834 }, "label": "Dramatic_Lighting_Photography", "type": "image", "content": "Dramatic_Lighting_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Dramatic Lighting Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 16:37:42", "filters": [ "Dark Still Life" ], "oldFilename": "Dramatic_Lighting_Photography-copy2.jpg" }, "10696": { "id": 10696, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 55637 }, "label": "dark photo of an aloe plant in orange pot", "type": "image", "content": "Living_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Living Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:51:20.440Z", "filters": [ "Dark Still Life" ], "oldFilename": "Living_Photography-copy2.jpg", "postDate": "2022-04-18T19:03:07.861Z", "keywords": [ "flowers", "flora", "bloom", "plant", "cactus", "potted" ], "searchable": true }, "10697": { "id": 10697, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 117183 }, "label": "iFood_Photography", "type": "image", "content": "iFood_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 16:52:23", "filters": [ "Food" ], "oldFilename": "iFood_Photography-copy1.jpg" }, "10698": { "id": 10698, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 120010 }, "label": "graphic arrangement of watermelon and asparagus on square plates", "type": "image", "content": "Graphic_Food_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food" ], "oldFilename": "Graphic_Food_Photography-copy1.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10698" }, "10699": { "id": 10699, "size": { "content": { "width": 854, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101043 }, "label": "Plant_Photography", "type": "image", "content": "Plant_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Plant Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03T23:55:53.000Z", "filters": [], "oldFilename": "Plant_Photography-copy1.jpg" }, "10700": { "id": 10700, "size": { "content": { "width": 854, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101043 }, "label": "Plant_Photography", "type": "image", "content": "Plant_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Plant Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-03 16:56:33", "filters": [ "Dark Still Life" ], "oldFilename": "Plant_Photography-copy2.jpg" }, "10701": { "id": 10701, "size": { "content": { "width": 2837, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 442637 }, "label": "adidas_Accessories_Photography", "type": "image", "content": "adidas_Accessories_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "adidas Accessories Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:08", "filters": [ "Recent" ], "oldFilename": "adidas_Accessories_Photography.jpg" }, "10702": { "id": 10702, "size": { "content": { "width": 1559, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 229078 }, "label": "adidas_Footwear_Photography", "type": "image", "content": "adidas_Footwear_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "adidas Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08T23:46:09.000Z", "filters": [], "oldFilename": "adidas_Footwear_Photography-copy1.jpg" }, "10703": { "id": 10703, "size": { "content": { "width": 832, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 207906 }, "label": "birthday cake on tan background weight watchers ", "type": "image", "content": "Cake_Happens-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Cake Happens", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Recent", "removed from overview" ], "oldFilename": "Cake_Happens-copy1.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10703" }, "10704": { "id": 10704, "size": { "content": { "width": 1563, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 400022 }, "label": "Eastbay_Footwear_Photography", "type": "image", "content": "Eastbay_Footwear_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Eastbay Footwear Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08T23:46:11.000Z", "filters": [], "oldFilename": "Eastbay_Footwear_Photography.jpg" }, "10705": { "id": 10705, "size": { "content": { "width": 1499, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 189785 }, "label": "Eastbay_Takeover_Photography", "type": "image", "content": "Eastbay_Takeover_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Eastbay Takeover Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:12", "filters": [ "Recent" ], "oldFilename": "Eastbay_Takeover_Photography.jpg" }, "10706": { "id": 10706, "size": { "content": { "width": 895, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 191419 }, "label": "Haworth_Photography", "type": "image", "content": "Haworth_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Haworth Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:31", "filters": [ "Recent" ], "oldFilename": "Haworth_Photography.jpg" }, "10707": { "id": 10707, "size": { "content": { "width": 929, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174451 }, "label": "HGTV_Photography", "type": "image", "content": "HGTV_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "HGTV Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:33", "filters": [ "Recent" ], "oldFilename": "HGTV_Photography.jpg" }, "10708": { "id": 10708, "size": { "content": { "width": 1499, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269112 }, "label": "Nike_Apparel_Photography", "type": "image", "content": "Nike_Apparel_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Apparel Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:51", "filters": [ "Recent" ], "oldFilename": "Nike_Apparel_Photography.jpg" }, "10709": { "id": 10709, "size": { "content": { "width": 1681, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 529387 }, "label": "Outside_Magazine_Laydown", "type": "image", "content": "Outside_Magazine_Laydown.jpg", "thumb": "", "linkTarget": "", "caption": "Outside Magazine Laydown", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:55", "filters": [ "Recent" ], "oldFilename": "Outside_Magazine_Laydown.jpg" }, "10710": { "id": 10710, "size": { "content": { "width": 2966, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 287260 }, "label": "Rainbow_Footwear_Photo", "type": "image", "content": "Rainbow_Footwear_Photo.jpg", "thumb": "", "linkTarget": "", "caption": "Rainbow Footwear Photo", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:46:58", "filters": [ "Recent" ], "oldFilename": "Rainbow_Footwear_Photo.jpg" }, "10711": { "id": 10711, "size": { "content": { "width": 866, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 122615 }, "label": "Rifle_Photography_Portland", "type": "image", "content": "Rifle_Photography_Portland.jpg", "thumb": "", "linkTarget": "", "caption": "Rifle Photography Portland", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:47:19", "filters": [ "Recent" ], "oldFilename": "Rifle_Photography_Portland.jpg", "postDate": "2019-02-07T19:51:45.951Z" }, "10712": { "id": 10712, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 363282 }, "label": "Sapa_Photography", "type": "image", "content": "Sapa_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Sapa Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:47:22", "filters": [ "Recent" ], "oldFilename": "Sapa_Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z" }, "10713": { "id": 10713, "size": { "content": { "width": 928, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 159427 }, "label": "Sherwin_Williams_Photography", "type": "image", "content": "Sherwin_Williams_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Sherwin Williams Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:47:27", "filters": [ "Recent", "removed from overview" ], "oldFilename": "Sherwin_Williams_Photography.jpg", "postDate": "2022-04-18T19:48:36.687Z" }, "10714": { "id": 10714, "size": { "content": { "width": 844, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 172212 }, "label": "Technology_Photography", "type": "image", "content": "Technology_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Technology Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08T23:47:31.000Z", "filters": [], "oldFilename": "Technology_Photography.jpg", "postDate": "2022-04-18T19:53:51.695Z" }, "10715": { "id": 10715, "size": { "content": { "width": 1680, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 382165 }, "label": "Weight_Watchers_Cake_Photography", "type": "image", "content": "Weight_Watchers_Cake_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Weight Watchers Cake Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 16:47:37", "filters": [ "Recent", "removed from overview" ], "oldFilename": "Weight_Watchers_Cake_Photography.jpg" }, "10716": { "id": 10716, "size": { "content": { "width": 1013, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174297 }, "label": "untitled", "type": "image", "content": "Technology_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 18:40:40", "filters": [ "Recent" ], "oldFilename": "Technology_Photography-copy1.jpg" }, "10717": { "id": 10717, "size": { "content": { "width": 2646, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 307246 }, "label": "Nike_Swoosh_Photography", "type": "image", "content": "Nike_Swoosh_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-09T01:41:55.000Z", "filters": [], "oldFilename": "Nike_Swoosh_Photography-copy1.jpg" }, "10718": { "id": 10718, "size": { "content": { "width": 1501, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 424861 }, "label": "adidas_footwear_photography", "type": "image", "content": "adidas_footwear_photography.jpg", "thumb": "", "linkTarget": "", "caption": "adidas footwear photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 18:42:56", "filters": [ "Recent" ], "oldFilename": "adidas_footwear_photography.jpg" }, "10719": { "id": 10719, "size": { "content": { "width": 1651, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269324 }, "label": "footwear_photography_portland", "type": "image", "content": "footwear_photography_portland.jpg", "thumb": "", "linkTarget": "", "caption": "footwear photography portland", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 18:42:57", "filters": [ "Recent" ], "oldFilename": "footwear_photography_portland.jpg" }, "10720": { "id": 10720, "size": { "content": { "width": 1013, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174297 }, "label": "Technology_Photography", "type": "image", "content": "Technology_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "Technology Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 18:44:21", "filters": [ "Recent", "removed from overview" ], "oldFilename": "Technology_Photography-copy2.jpg" }, "10721": { "id": 10721, "size": { "content": { "width": 2646, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 307246 }, "label": "Nike_Swoosh_Photography", "type": "image", "content": "Nike_Swoosh_Photography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-09T01:47:55.000Z", "filters": [], "oldFilename": "Nike_Swoosh_Photography-copy2.jpg" }, "10722": { "id": 10722, "size": { "content": { "width": 2646, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 307246 }, "label": "Nike_Swoosh_Photography", "type": "image", "content": "Nike_Swoosh_Photography-copy3.jpg", "thumb": "", "linkTarget": "", "caption": "Nike Swoosh Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-06-08 18:48:36", "filters": [ "Recent", "removed from overview" ], "oldFilename": "Nike_Swoosh_Photography-copy3.jpg" }, "10723": { "id": 10723, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 392551 }, "label": "homemade gyoza with wasabi peas and crackers", "type": "image", "content": "JGS_Soy_Vay.jpg", "thumb": "", "linkTarget": "", "caption": "JGS Soy Vay", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-06T20:57:32.771Z", "filters": [ "Food" ], "oldFilename": "JGS_Soy_Vay.jpg", "key": "10723" }, "10724": { "id": 10724, "size": { "content": { "width": 1546, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 521767 }, "label": "Soy_Vay_Rebranding", "type": "image", "content": "Soy_Vay_Rebranding.jpg", "thumb": "", "linkTarget": "", "caption": "Soy Vay Rebranding", "overrides": {}, "featuredImage": "", "dateAdded": "2015-10-07 16:03:50", "filters": [ "Food" ], "oldFilename": "Soy_Vay_Rebranding.jpg" }, "10725": { "id": 10725, "size": { "content": { "width": 1509, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 635665 }, "label": "Jim_Golden_Soy_Vay", "type": "image", "content": "Jim_Golden_Soy_Vay.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-11-10 13:23:14", "filters": [ "Soy Vay adds" ], "oldFilename": "Jim_Golden_Soy_Vay.jpg" }, "10726": { "id": 10726, "size": { "content": { "width": 1362, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 614546 }, "label": "Asian_Food_Photography", "type": "image", "content": "Asian_Food_Photography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "Asian Food Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-06T20:57:32.772Z", "filters": [ "Soy Vay adds" ], "oldFilename": "Asian_Food_Photography-copy1.jpg" }, "10727": { "id": 10727, "size": { "content": { "width": 1397, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 521246 }, "label": "asian noodle salad with grilled vegetables", "type": "image", "content": "Jim_Golden_Asian_Food.jpg", "thumb": "", "linkTarget": "", "caption": "Jim Golden Asian Food", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.762Z", "filters": [ "Soy Vay adds" ], "oldFilename": "Jim_Golden_Asian_Food.jpg", "key": "10727" }, "10728": { "id": 10728, "size": { "content": { "width": 1509, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 511801 }, "label": "Jim_Golden_Soy_Vay", "type": "image", "content": "Jim_Golden_Soy_Vay-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2015-11-10 13:50:47", "filters": [ "Soy Vay adds" ], "oldFilename": "Jim_Golden_Soy_Vay-copy1.jpg" }, "10729": { "id": 10729, "size": { "content": { "width": 1489, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 644419 }, "label": "Portland_Food_Photographer", "type": "image", "content": "Portland_Food_Photographer.jpg", "thumb": "", "linkTarget": "", "caption": "Portland Food Photographer", "overrides": {}, "featuredImage": "", "dateAdded": "2015-11-10 13:50:48", "filters": [ "Soy Vay adds" ], "oldFilename": "Portland_Food_Photographer.jpg" }, "10730": { "id": 10730, "size": { "content": { "width": 1461, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 501990 }, "label": "bowtie pasta and vegetable salad in orange bowl", "type": "image", "content": "Soy_Vay_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Soy Vay Photography", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-06T20:57:32.773Z", "filters": [ "Soy Vay adds" ], "key": "10730" }, "10731": { "id": 10731, "size": { "content": { "width": 1506, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 647336 }, "label": "Soy_Vay_Rebranding_Photography", "type": "image", "content": "Soy_Vay_Rebranding_Photography.jpg", "thumb": "", "linkTarget": "", "caption": "Soy Vay Rebranding Photography", "overrides": {}, "featuredImage": "", "dateAdded": "2015-11-10 13:50:51", "filters": [ "Soy Vay adds" ], "oldFilename": "Soy_Vay_Rebranding_Photography.jpg" }, "10732": { "id": 10732, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Buy Art Prints", "type": "link", "content": "http://jimgoldenstudio.bigcartel.com/", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-07-07T00:51:48.000Z", "filters": [], "key": "10732" }, "10733": { "id": 10733, "size": { "content": { "width": 1714, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 364654 }, "label": "adidas photographer", "type": "image", "content": "adidasphotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:10:31", "filters": [ "Footwear" ], "oldFilename": "adidas photographer.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10734": { "id": 10734, "size": { "content": { "width": 1713, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 251979 }, "label": "adidas superstar horween limited edition", "type": "image", "content": "adidasphotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:11.402Z", "filters": [ "Footwear" ], "oldFilename": "adidas photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10735": { "id": 10735, "size": { "content": { "width": 2093, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 526642 }, "label": "Footwear Photography", "type": "image", "content": "FootwearPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:10:36", "filters": [ "Footwear" ], "oldFilename": "Footwear Photography.jpg" }, "10736": { "id": 10736, "size": { "content": { "width": 1892, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 166924 }, "label": "footwear portland photos", "type": "image", "content": "footwearportlandphotos.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:10:37", "filters": [ "Footwear" ], "oldFilename": "footwear portland photos.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10737": { "id": 10737, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 97498 }, "label": "Hoka Clayton Photography", "type": "image", "content": "HokaClaytonPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:10:38", "filters": [ "Footwear" ], "oldFilename": "Hoka Clayton Photography.jpg" }, "10738": { "id": 10738, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 309805 }, "label": "james harden adidas shoe release", "type": "image", "content": "Portlandadidasphotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:11.402Z", "filters": [ "Footwear", "removed from overview" ], "oldFilename": "Portland adidas photographer.jpg", "postDate": "2019-01-30T23:44:33.791Z", "key": "10738", "searchable": true }, "10739": { "id": 10739, "size": { "content": { "width": 1354, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108382 }, "label": "adidas gazelle colorful footwear pattern", "type": "image", "content": "portlandfootwearphotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:11.402Z", "filters": [ "Footwear", "removed from overview" ], "oldFilename": "portland footwear photography.jpg", "postDate": "2019-07-21T18:55:18.639Z" }, "10740": { "id": 10740, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 89426 }, "label": "Portland Footwear Photos", "type": "image", "content": "PortlandFootwearPhotos.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:10:39", "filters": [ "Footwear" ], "oldFilename": "Portland Footwear Photos.jpg" }, "10741": { "id": 10741, "size": { "content": { "width": 1677, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 117865 }, "label": "adidas superstar sneaker black and white pattern", "type": "image", "content": "PortlandShoePhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:11.402Z", "filters": [ "Footwear", "removed from overview" ], "oldFilename": "Portland Shoe Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10742": { "id": 10742, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 133772 }, "label": "Reebok Photography", "type": "image", "content": "ReebokPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:10:41", "filters": [ "Footwear", "removed from overview" ], "oldFilename": "Reebok Photography.jpg" }, "10743": { "id": 10743, "size": { "content": { "width": 1834, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 511103 }, "label": "Shoe Photography", "type": "image", "content": "ShoePhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13T21:10:42.000Z", "filters": [], "oldFilename": "Shoe Photography.jpg" }, "10744": { "id": 10744, "size": { "content": { "width": 1939, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 433043 }, "label": "zPump Photography", "type": "image", "content": "zPumpPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13T21:10:42.000Z", "filters": [], "oldFilename": "zPump Photography.jpg" }, "10745": { "id": 10745, "size": { "content": { "width": 1482, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 138533 }, "label": "Footwear Photography Portland", "type": "image", "content": "FootwearPhotographyPortland.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-09-13 14:16:09", "filters": [ "Footwear" ], "oldFilename": "Footwear Photography Portland.jpg" }, "10746": { "id": 10746, "size": { "content": { "width": 1364, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 86080 }, "label": "Alternative Food Photography", "type": "image", "content": "AlternativeFoodPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-05T00:06:01.252Z", "filters": [ "Dark Still Life", "removed from overview" ], "key": "10746", "postDate": "2019-02-06T21:08:32.045Z" }, "10747": { "id": 10747, "size": { "content": { "width": 1364, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 47305 }, "label": "sexy dark yam photo on black ", "type": "image", "content": "UniqueFoodPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2019-02-05T00:06:01.252Z", "filters": [ "Dark Still Life", "removed from overview" ], "key": "10747", "postDate": "2022-04-18T18:50:09.900Z" }, "10748": { "id": 10748, "size": { "content": { "width": 1521, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 368251 }, "label": "Salmon on a bed of greens", "type": "image", "content": "AsianFoodPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-06T20:57:32.771Z", "filters": [ "Food", "removed from overview" ], "key": "10748" }, "10749": { "id": 10749, "size": { "content": { "width": 1140, "height": 1425 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 382731 }, "label": "bobs red mill paleo flour finished recipes", "type": "image", "content": "BakingEditorialPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food", "removed from overview" ], "oldFilename": "Baking Editorial Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10749" }, "10750": { "id": 10750, "size": { "content": { "width": 1140, "height": 1423 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 502483 }, "label": "bobs red mill assortment of flour on butcher block", "type": "image", "content": "BakingPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:09.323Z", "filters": [ "Food" ], "oldFilename": "Baking Photography.jpg", "postDate": "2019-01-30T23:44:09.211Z", "key": "10750" }, "10751": { "id": 10751, "size": { "content": { "width": 1518, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 384150 }, "label": "seared tuna recipe on nautical theme background", "type": "image", "content": "FishCookingPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:08:51.762Z", "filters": [ "Food", "removed from overview" ], "oldFilename": "Fish Cooking Photography.jpg", "key": "10751" }, "10752": { "id": 10752, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 369309 }, "label": "Portland Food Photographer", "type": "image", "content": "PortlandFoodPhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-05 15:43:38", "filters": [ "Food", "removed from overview" ], "oldFilename": "Portland Food Photographer.jpg" }, "10753": { "id": 10753, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 240189 }, "label": "basket of bread with a butter dish", "type": "image", "content": "PortlandFoodPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:19:19.594Z", "filters": [ "Food", "removed from overview" ], "oldFilename": "Portland Food Photography.jpg", "postDate": "2019-02-06T19:06:25.922Z", "key": "10753" }, "10754": { "id": 10754, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106867 }, "label": "having a glass of red wine while wrapping gifts", "type": "image", "content": "PortlandHolidayPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:19:19.593Z", "filters": [ "Food", "removed from overview" ], "oldFilename": "Portland Holiday Photography.jpg", "postDate": "2019-02-06T19:06:25.922Z", "key": "10754" }, "10755": { "id": 10755, "size": { "content": { "width": 814, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 114025 }, "label": "pile of holiday food classics on a dark red background", "type": "image", "content": "ThanksgivingFoodPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:19:19.593Z", "filters": [ "Food", "removed from overview" ], "oldFilename": "Thanksgiving Food Photography.jpg", "postDate": "2019-02-06T19:06:25.922Z", "key": "10755" }, "10756": { "id": 10756, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174375 }, "label": "classic holiday turkey with a bowl on stuffing", "type": "image", "content": "ThanksgivingPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:19:19.593Z", "filters": [ "Food", "removed from overview" ], "oldFilename": "Thanksgiving Photography.jpg", "postDate": "2019-02-06T19:06:25.922Z", "key": "10756" }, "10757": { "id": 10757, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 389360 }, "label": "soba noodles with avocado and other vegetables", "type": "image", "content": "UniqueAsianFoodPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-06T20:57:32.771Z", "filters": [ "Food", "removed from overview" ], "key": "10757" }, "10758": { "id": 10758, "size": { "content": { "width": 2474, "height": 469 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 43602 }, "label": "dark female nude photo", "type": "image", "content": "BodyIssuePhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-07T20:20:52.391Z", "filters": [ "Dark Still Life", "removed from overview" ], "key": "10758" }, "10759": { "id": 10759, "size": { "content": { "width": 401, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108373 }, "label": "Cleaning Product Photography", "type": "image", "content": "CleaningProductPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-05T22:53:15.000Z", "filters": [], "oldFilename": "Cleaning Product Photography.jpg" }, "10760": { "id": 10760, "size": { "content": { "width": 401, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108373 }, "label": "Cleaning Product Photography", "type": "image", "content": "CleaningProductPhotography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-05 15:53:40", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Cleaning Product Photography-copy1.jpg", "postDate": "2020-05-04T23:15:42.995Z", "key": "10760" }, "10761": { "id": 10761, "size": { "content": { "width": 879, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 197163 }, "label": "Field and Stream ultimate survival gear magazine cover", "type": "image", "content": "FieldandStreamCoverShot.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T23:02:34.805Z", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Field and Stream Cover Shot.jpg", "postDate": "2019-02-06T19:31:01.686Z", "key": "10761" }, "10762": { "id": 10762, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 220874 }, "label": "graphic pattern of nike shoe boxes", "type": "image", "content": "FootwearGraphicPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:07.168Z", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Footwear Graphic Photography.jpg", "postDate": "2019-01-30T23:44:05.027Z", "key": "10762" }, "10763": { "id": 10763, "size": { "content": { "width": 2002, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 593555 }, "label": "Portland Sportswear Photographer", "type": "image", "content": "PortlandSportswearPhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-05 15:56:41", "filters": [ "Apparel" ], "oldFilename": "Portland Sportswear Photographer.jpg" }, "10764": { "id": 10764, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 27719 }, "label": "Pouring Photography", "type": "image", "content": "PouringPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-05 15:57:27", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Pouring Photography.jpg", "postDate": "2020-09-23T23:37:25.621Z" }, "10765": { "id": 10765, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 310511 }, "label": "adidas yoga outfit on the beach", "type": "image", "content": "SportswearPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-19T22:34:41.080Z", "filters": [ "Apparel", "removed from overview" ], "oldFilename": "Sportswear Photography.jpg", "postDate": "2020-05-04T22:37:39.876Z" }, "10766": { "id": 10766, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 241773 }, "label": "Sportwear Photographer", "type": "image", "content": "SportwearPhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-05 15:59:09", "filters": [ "Apparel", "removed from overview" ], "oldFilename": "Sportwear Photographer.jpg" }, "10767": { "id": 10767, "size": { "content": { "width": 2987, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 693959 }, "label": "Travelocity Photographer", "type": "image", "content": "TravelocityPhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06T18:18:55.000Z", "filters": [], "oldFilename": "Travelocity Photographer.jpg" }, "10768": { "id": 10768, "size": { "content": { "width": 2989, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 833571 }, "label": "Travelocity Photography", "type": "image", "content": "TravelocityPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06T18:18:57.000Z", "filters": [], "oldFilename": "Travelocity Photography.jpg" }, "10769": { "id": 10769, "size": { "content": { "width": 967, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101077 }, "label": "Outside Magazine Photographer", "type": "image", "content": "OutsideMagazinePhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06 11:21:31", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Outside Magazine Photographer.jpg", "postDate": "2019-02-06T19:31:32.545Z" }, "10770": { "id": 10770, "size": { "content": { "width": 967, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101077 }, "label": "Outside Magazine Photographer", "type": "image", "content": "OutsideMagazinePhotographer-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06T18:21:54.000Z", "filters": [], "oldFilename": "Outside Magazine Photographer-copy1.jpg" }, "10771": { "id": 10771, "size": { "content": { "width": 2007, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 607905 }, "label": "Portland Athleticwear Photography", "type": "image", "content": "PortlandAthleticwearPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06 11:23:23", "filters": [ "Apparel", "removed from overview" ], "oldFilename": "Portland Athleticwear Photography.jpg" }, "10772": { "id": 10772, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 57932 }, "label": "Hoka Footwear Photography", "type": "image", "content": "HokaFootwearPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06 11:24:14", "filters": [ "Footwear" ], "oldFilename": "Hoka Footwear Photography.jpg" }, "10773": { "id": 10773, "size": { "content": { "width": 2987, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 693959 }, "label": "Travelocity Photographer", "type": "image", "content": "TravelocityPhotographer-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06 11:28:15", "filters": [ "Apparel" ], "oldFilename": "Travelocity Photographer-copy1.jpg" }, "10774": { "id": 10774, "size": { "content": { "width": 2989, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 833571 }, "label": "Travelocity Photography", "type": "image", "content": "TravelocityPhotography-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06 11:28:20", "filters": [ "removed from overview" ], "oldFilename": "Travelocity Photography-copy1.jpg" }, "10775": { "id": 10775, "size": { "content": { "width": 640, "height": 640 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 111155 }, "label": "SubstandardFullSizeRender-2", "type": "image", "content": "SubstandardFullSizeRender-2.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-06T19:01:25.000Z", "filters": [], "oldFilename": "SubstandardFullSizeRender-2.jpg" }, "10776": { "id": 10776, "size": { "content": { "width": 3025, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 845211 }, "label": "travelocity wander wisely vancouver airport collection", "type": "image", "content": "TravelocityPhotography-copy2.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T22:39:03.643Z", "filters": [ "Apparel" ], "oldFilename": "Travelocity Photography-copy2.jpg", "postDate": "2019-02-07T00:38:31.162Z", "key": "10776" }, "10779": { "id": 10779, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 10130534 }, "label": "20120614-STEREOS_0081_1080i_FLAT_2", "type": "video", "content": "20120614-STEREOS_0081_1080i_FLAT_2-copy1.mp4", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07 15:45:49", "filters": [ "Motion" ], "oldFilename": "20120614-STEREOS_0081_1080i_FLAT_2-copy1.mp4" }, "10780": { "id": 10780, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 2000, "height": 1500 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 10130534 }, "label": "20120614-STEREOS_0081_1080i_FLAT_2", "type": "video", "content": "20120614-STEREOS_0081_1080i_FLAT_2-copy2.mp4", "thumb": "20120614-STEREOS_0081_2K_FLAT.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07 15:46:47", "filters": [ "Motion" ], "oldFilename": "20120614-STEREOS_0081_1080i_FLAT_2-copy2.mp4", "oldThumb": "20120614-STEREOS_0081_2K_FLAT.jpg" }, "10781": { "id": 10781, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 2000, "height": 1500 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 26075633 }, "label": "20120614-STEREOS_0081_2K_FLAT", "type": "video", "content": "20120614-STEREOS_0081_2K_FLAT-copy1.mov", "thumb": "20120614-STEREOS_0081_2K_FLAT-copy3.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07 15:55:40", "filters": [ "Motion" ], "oldFilename": "20120614-STEREOS_0081_2K_FLAT-copy1.mov", "oldThumb": "20120614-STEREOS_0081_2K_FLAT-copy3.jpg" }, "10782": { "id": 10782, "size": { "content": { "width": 1920, "height": 1080 }, "thumb": { "width": 2000, "height": 1500 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": false }, "label": "Stereo", "type": "video", "content": "vimeo:186011038", "thumb": "20120614-STEREOS_0081_2K_FLAT-copy5.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07T23:15:07.000Z", "filters": [], "oldThumb": "20120614-STEREOS_0081_2K_FLAT-copy5.jpg", "postDate": "2019-02-07T19:22:16.933Z" }, "10783": { "id": 10783, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 2000, "height": 1500 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": false }, "label": "Stereo", "type": "video", "content": "vimeo:186011038", "thumb": "20120614-STEREOS_0081_2K_FLAT-copy6.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07 16:18:46", "filters": [ "Motion" ], "oldThumb": "20120614-STEREOS_0081_2K_FLAT-copy6.jpg" }, "10784": { "id": 10784, "size": { "content": { "width": 1232, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106313 }, "label": "CR-CLOROX-S2-BURTS-BEES_1324", "type": "image", "content": "CR-CLOROX-S2-BURTS-BEES_1324.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07T23:35:24.000Z", "filters": [], "oldFilename": "CR-CLOROX-S2-BURTS-BEES_1324.jpg" }, "10785": { "id": 10785, "size": { "content": { "width": 977, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 167554 }, "label": "Glad trash bag overstuffed to the max", "type": "image", "content": "CR-CLOROX-S2-GLAD-TRASH_1461.jpg", "thumb": "", "linkTarget": "", "caption": "Photo of a grey trash bag with a red tie stuffed to its maximum on white background ", "overrides": {}, "featuredImage": "", "dateAdded": "2020-09-23T23:28:52.799Z", "filters": [], "oldFilename": "CR-CLOROX-S2-GLAD-TRASH_1461.jpg", "postDate": "2020-09-23T23:31:39.719Z", "key": "10785" }, "10786": { "id": 10786, "size": { "content": { "width": 1232, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106313 }, "label": "CR-CLOROX-S2-BURTS-BEES_1324", "type": "image", "content": "CR-CLOROX-S2-BURTS-BEES_1324-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07T23:37:01.000Z", "filters": [], "oldFilename": "CR-CLOROX-S2-BURTS-BEES_1324-copy1.jpg" }, "10787": { "id": 10787, "size": { "content": { "width": 977, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 167554 }, "label": "CR-CLOROX-S2-GLAD-TRASH_1461", "type": "image", "content": "CR-CLOROX-S2-GLAD-TRASH_1461-copy1.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-07T23:37:02.000Z", "filters": [], "oldFilename": "CR-CLOROX-S2-GLAD-TRASH_1461-copy1.jpg" }, "10788": { "id": 10788, "size": { "content": { "width": 1451, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 361204 }, "label": "hoka one one marshmallow soft running shoe", "type": "image", "content": "ActivewearMotionPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-28T21:53:11.402Z", "filters": [ "Footwear" ], "oldFilename": "Activewear Motion Photography.jpg", "postDate": "2019-01-30T23:44:33.791Z" }, "10789": { "id": 10789, "size": { "content": { "width": 1451, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 227314 }, "label": "Footwear Motion Photography", "type": "image", "content": "FootwearMotionPhotography.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-11 18:56:44", "filters": [ "Footwear" ], "oldFilename": "Footwear Motion Photography.jpg" }, "10790": { "id": 10790, "size": { "content": { "width": 2500, "height": 3750 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 7928770 }, "label": "HOKA-CLIFTON-PARIS-WOMENS-ANI", "type": "image", "content": "HOKA-CLIFTON-PARIS-WOMENS-ANI.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-12T19:16:50.000Z", "filters": [], "oldFilename": "HOKA-CLIFTON-PARIS-WOMENS-ANI.gif" }, "10791": { "id": 10791, "size": { "content": { "width": 2500, "height": 3750 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 12599409 }, "label": "HOKA-CLIFTON-NYC-MENS-ANI", "type": "image", "content": "HOKA-CLIFTON-NYC-MENS-ANI.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-12T19:17:01.000Z", "filters": [], "oldFilename": "HOKA-CLIFTON-NYC-MENS-ANI.gif" }, "10792": { "id": 10792, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1113923 }, "label": "hoka clifton one tasty ride NYC animation GIF", "type": "image", "content": "HOKA-CLIFTON-NYC-MENS-ANI-copy1.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:24:38.227Z", "filters": [], "oldFilename": "HOKA-CLIFTON-NYC-MENS-ANI-copy1.gif", "postDate": "2019-02-07T19:18:22.547Z", "key": "10792" }, "10793": { "id": 10793, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 582815 }, "label": "HOKA-CLIFTON-PARIS-WOMENS-ANI", "type": "image", "content": "HOKA-CLIFTON-PARIS-WOMENS-ANI-copy1.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-12T19:24:00.000Z", "filters": [], "oldFilename": "HOKA-CLIFTON-PARIS-WOMENS-ANI-copy1.gif", "postDate": "2019-02-07T19:03:07.339Z" }, "10801": { "id": 10801, "size": { "content": { "width": 1296, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 6275378 }, "label": "HOKA-CLAYTON-BURN-ANI-MENS_NEW", "type": "image", "content": "HOKA-CLAYTON-BURN-ANI-MENS_NEW.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-12T20:55:39.000Z", "filters": [], "oldFilename": "HOKA-CLAYTON-BURN-ANI-MENS_NEW.gif" }, "10802": { "id": 10802, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2620142 }, "label": "HOKA-FEATHERS-ANI_0755-V2", "type": "image", "content": "HOKA-FEATHERS-ANI_0755-V2.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-12T22:00:14.000Z", "filters": [], "oldFilename": "HOKA-FEATHERS-ANI_0755-V2.gif" }, "10803": { "id": 10803, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 145254 }, "label": "Cleaning Still Life Photographer", "type": "image", "content": "CleaningStillLifePhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-17 16:59:41", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Cleaning Still Life Photographer.jpg", "postDate": "2019-02-07T18:53:21.625Z" }, "10804": { "id": 10804, "size": { "content": { "width": 977, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 200327 }, "label": "Cleaning Supply Photographer", "type": "image", "content": "CleaningSupplyPhotographer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-17 16:59:44", "filters": [ "Still Life", "removed from overview" ], "oldFilename": "Cleaning Supply Photographer.jpg", "postDate": "2019-02-07T18:53:21.625Z" }, "10805": { "id": 10805, "size": { "content": { "width": 1140, "height": 1710 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2134949 }, "label": "HOKA-CLIFTON-NYC-WOMENS-ANI", "type": "image", "content": "HOKA-CLIFTON-NYC-WOMENS-ANI.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-26 12:08:25", "filters": [ "Motion" ], "oldFilename": "HOKA-CLIFTON-NYC-WOMENS-ANI.gif" }, "10806": { "id": 10806, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4074025 }, "label": "hoka one one clayton so fast it singes marshmallows", "type": "image", "content": "HOKA-CLAYTON-BURN-ANI-MENS_V2.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:48:36.403Z", "filters": [ "Motion" ], "postDate": "2021-09-09T19:06:35.336Z", "key": "10806", "searchable": true }, "10807": { "id": 10807, "size": { "content": { "width": 1920, "height": 1440 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4089572 }, "label": "hoka one one shoe light as a feather", "type": "image", "content": "HOKA-FEATHERS-ANI_0755-V3.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-12T22:48:36.403Z", "filters": [ "Motion" ], "oldFilename": "HOKA-FEATHERS-ANI_0755-V3.gif", "postDate": "2019-02-07T18:54:28.118Z", "key": "10807" }, "10808": { "id": 10808, "size": { "content": { "width": 1140, "height": 1710 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2134949 }, "label": "HOKA-CLIFTON-NYC-WOMENS-ANI", "type": "image", "content": "HOKA-CLIFTON-NYC-WOMENS-ANI-copy1.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2016-10-26 12:42:32", "filters": [ "Motion" ], "oldFilename": "HOKA-CLIFTON-NYC-WOMENS-ANI-copy1.gif", "postDate": "2019-02-07T18:54:28.118Z", "key": "10808" }, "10809": { "id": 10809, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 85469 }, "label": "hoka one one light as a feather running shoe", "type": "image", "content": "HOKA-FEATHERS-ANI_0755_V2.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2017-04-06T21:46:18.656Z", "filters": [ "Footwear", "removed from overview" ], "oldFilename": "HOKA-FEATHERS-ANI_0755_V2.jpg", "key": "10809", "postDate": "2021-09-09T19:06:35.336Z", "searchable": true }, "10810": { "id": 10810, "size": { "content": { "width": 1919, "height": 1049 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 590780 }, "label": "DC-STUDIO", "type": "image", "content": "DC-STUDIO.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-02-17T03:08:19.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10811": { "id": 10811, "size": { "content": { "width": 381, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 127839 }, "label": "soy-vay-food-photo-jim-golden", "type": "image", "content": "soy-vay-food-photo-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Sat, 25 Feb 2017 00:33:59 GMT", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "Recent", "removed from overview" ] }, "10812": { "id": 10812, "size": { "content": { "width": 381, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 158676 }, "label": "soy-vay-food-photogrpahy-jim-golden", "type": "image", "content": "soy-vay-food-photogrpahy-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Sat, 25 Feb 2017 00:34:01 GMT", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "Recent", "removed from overview" ] }, "10813": { "id": 10813, "size": { "content": { "width": 1860, "height": 1364 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 175884 }, "label": "modular desk system practical application", "type": "image", "content": "los-osos-srix-jim-golden.jpg", "thumb": "", "linkTarget": "", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "overrides": {}, "featuredImage": "", "dateAdded": "2017-02-25T00:41:12.000Z", "filters": [ "Recent", "removed from overview" ], "key": "10813" }, "10814": { "id": 10814, "size": { "content": { "width": 1860, "height": 1588 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 209322 }, "label": "furniture-photography-jim-golden", "type": "image", "content": "furniture-photography-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Sat, 25 Feb 2017 00:41:14 GMT", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "Recent" ] }, "10815": { "id": 10815, "size": { "content": { "width": 1860, "height": 1365 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 129937 }, "label": "furniture-photography-studio-jim-golden", "type": "image", "content": "furniture-photography-studio-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Sat, 25 Feb 2017 00:41:16 GMT", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "Recent" ] }, "10816": { "id": 10816, "size": { "content": { "width": 1860, "height": 1588 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 210521 }, "label": "pieces of a modular desk system", "type": "image", "content": "furniture-photography-jim-golden-copy.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-02-25T00:47:28.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:05.027Z", "key": "10816" }, "10817": { "id": 10817, "size": { "content": { "width": 2404, "height": 3153 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 579164 }, "label": "illogical fast hoka one one clayton 2 shoe", "type": "image", "content": "HOK077_Clayton2_W_Thunderbolt.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2017-04-03T23:55:14.000Z", "filters": [ "removed from overview" ], "key": "10817", "postDate": "2021-09-09T19:06:35.336Z", "searchable": true }, "10818": { "id": 10818, "size": { "content": { "width": 2398, "height": 3153 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 602628 }, "label": "inconceivable clayton 2 hoka one one running shoe green", "type": "image", "content": "HOK077_Clayton2_M_Rocket.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-04-03T23:55:17.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "key": "10818", "postDate": "2021-09-09T19:06:35.336Z", "searchable": true }, "10819": { "id": 10819, "size": { "content": { "width": 906, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 200753 }, "label": "food-photography-carrots-celery", "type": "image", "content": "food-photography-carrots-celery.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Thu, 06 Apr 2017 21:43:07 GMT", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z" }, "10820": { "id": 10820, "size": { "content": { "width": 1004, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 202235 }, "label": "food-photography-potato-chips", "type": "image", "content": "food-photography-potato-chips.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Thu, 06 Apr 2017 21:43:10 GMT", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z" }, "10821": { "id": 10821, "size": { "content": { "width": 895, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 159860 }, "label": "food-photography-pretzels", "type": "image", "content": "food-photography-pretzels.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Thu, 06 Apr 2017 21:43:12 GMT", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z" }, "10822": { "id": 10822, "size": { "content": { "width": 1860, "height": 1387 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 396036 }, "label": "food-photography-saltines", "type": "image", "content": "food-photography-saltines.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-04-06T21:43:15.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z" }, "10823": { "id": 10823, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 299837 }, "label": "air pocket packaging product that looks like a snake", "type": "image", "content": "air-pocket-packaging-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:23.000Z", "caption": "air pocket packaging product that looks like a snake", "featuredImage": "", "overrides": { "thumbScaleFactor": false }, "filters": [ "removed from overview" ], "postDate": "2019-02-01T02:09:30.581Z", "key": "10823" }, "10824": { "id": 10824, "size": { "content": { "width": 981, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 324586 }, "label": "bloody-mary-cocktail-photography-jim-golden", "type": "image", "content": "bloody-mary-cocktail-photography-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:46:25 GMT", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2020-05-04T22:48:28.989Z", "key": "10824" }, "10825": { "id": 10825, "size": { "content": { "width": 1326, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 301967 }, "label": "bacon lettuce tomato tic tac toe on yellow ", "type": "image", "content": "blt-bacon-lettuce-tomato-avocado-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:27.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z", "key": "10825" }, "10826": { "id": 10826, "searchable": true, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 287433 }, "label": "bacon lettuce tomato avocado sandwich", "type": "image", "content": "blt-blta-sandwich-food-jim-golden.jpg", "thumb": "", "linkTarget": "", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2017-07-19T21:46:29.000Z", "filters": [ "removed from overview" ], "key": "10826" }, "10827": { "id": 10827, "size": { "content": { "width": 1404, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 217805 }, "label": "inflatable packaging to ship wine bottles", "type": "image", "content": "bottle-packaging-inflatable-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:31.000Z", "caption": "inflatable packaging to ship wine bottles", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-02-01T02:12:03.615Z", "key": "10827" }, "10828": { "id": 10828, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 524275 }, "label": "bubble-wrap-jim-golden-still-life", "type": "image", "content": "bubble-wrap-jim-golden-still-life.jpg", "thumb": "", "linkTarget": "", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2017-07-19T21:46:34.000Z", "filters": [ "removed from overview" ], "key": "10828" }, "10829": { "id": 10829, "size": { "content": { "width": 1517, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 294144 }, "label": "buddahand-jim-golden-food", "type": "image", "content": "buddahand-jim-golden-food.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:46:37 GMT", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z" }, "10830": { "id": 10830, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 220237 }, "label": "single serve campari and soda on red background", "type": "image", "content": "campari-bottle-photography-red-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:39.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:05.027Z" }, "10831": { "id": 10831, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181386 }, "label": "dakon-radish-spiralized-jim-golden", "type": "image", "content": "dakon-radish-spiralized-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:46:41 GMT", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:55.978Z" }, "10832": { "id": 10832, "size": { "content": { "width": 920, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 155844 }, "label": "frozen ice cream treats stacked on a pink background", "type": "image", "content": "frozen-treats-ice-cream-popsicle-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:43.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": { "thumbScaleFactor": false }, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z", "key": "10832" }, "10833": { "id": 10833, "size": { "content": { "width": 670, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 172585 }, "label": "very tall ice cream cone ten scoops", "type": "image", "content": "ice-cream-cone-food-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:45.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z", "key": "10833" }, "10834": { "id": 10834, "size": { "content": { "width": 1646, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 416436 }, "label": "jimgolden-ginger-raw-food", "type": "image", "content": "jimgolden-ginger-raw-food.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:46:47 GMT", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z" }, "10835": { "id": 10835, "size": { "content": { "width": 1404, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 156179 }, "label": "kartel-ghost-chair-jim-golden", "type": "image", "content": "kartel-ghost-chair-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:46:49 GMT", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:05.027Z" }, "10836": { "id": 10836, "size": { "content": { "width": 1525, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 182867 }, "label": "makita-circular-saw-power-tools-jim-golden", "type": "image", "content": "makita-circular-saw-power-tools-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:52.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T19:57:18.420Z" }, "10837": { "id": 10837, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 307374 }, "label": "small bird eating pretzels out of a nest", "type": "image", "content": "pretzel-bird-nest-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:54.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": { "thumbScaleFactor": true }, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:09.211Z", "key": "10837" }, "10838": { "id": 10838, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 167910 }, "label": "salmon-head-fish-jim-golden", "type": "image", "content": "salmon-head-fish-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:46:56 GMT", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:55.978Z" }, "10839": { "id": 10839, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 114526 }, "label": "spaghetti squash knot that glows", "type": "image", "content": "squash-spaghetti-knot-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:46:58.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2022-04-18T18:50:19.440Z" }, "10840": { "id": 10840, "size": { "content": { "width": 1484, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 201215 }, "label": "abstract spiralized orange squash on black", "type": "image", "content": "squash-spiralized-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:47:00.000Z", "caption": "abstract spiralized orange squash on black", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2022-04-18T18:50:16.036Z", "key": "10840" }, "10841": { "id": 10841, "size": { "content": { "width": 1419, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261418 }, "label": "styrofoam wine bottle shipping package ", "type": "image", "content": "styrofoam-bottle-shipper-packaging-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:47:02.000Z", "caption": "styrofoam wine bottle shipping package ", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-02-01T02:11:09.209Z" }, "10842": { "id": 10842, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 351313 }, "label": "macro image of styrofoam board ", "type": "image", "content": "styrofoam-jim-golden-still-life.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:47:05.000Z", "caption": "macro image of styrofoam board ", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-02-01T02:16:28.405Z", "key": "10842" }, "10843": { "id": 10843, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 322059 }, "label": "styrofoam-packaging-jim-golden", "type": "image", "content": "styrofoam-packaging-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-07-19T21:47:08.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10844": { "id": 10844, "size": { "content": { "width": 1228, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 207089 }, "label": "trout-toast-bread-herbs-fish-jim-golden", "type": "image", "content": "trout-toast-bread-herbs-fish-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 19 Jul 2017 21:47:10 GMT", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:55.978Z" }, "10845": { "id": 10845, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 257866 }, "label": "staircase on the side of a turbine at Bonneville Dam yellow orange", "type": "image", "content": "20151101-DAM-POWERHOUSE-133.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2017-07-19T23:38:15.000Z", "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:05.027Z", "key": "10845" }, "10846": { "id": 10846, "size": { "content": { "width": 1860, "height": 1395 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 439414 }, "label": "styrofoam-packaging", "type": "image", "content": "styrofoam-packaging.jpg", "thumb": "", "linkTarget": "", "dateAdded": "Wed, 29 Nov 2017 22:31:33 GMT", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ] }, "10847": { "id": 10847, "size": { "content": { "width": 1860, "height": 1395 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 439414 }, "label": "styrofoam packaging sheets", "type": "image", "content": "styrofoam-packaging2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-11-29T22:34:56.000Z", "caption": "styrofoam packaging sheets", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-02-01T02:07:19.339Z", "key": "10847" }, "10848": { "id": 10848, "size": { "content": { "width": 1141, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 408582 }, "label": "packing peanuts of different varieties", "type": "image", "content": "packing-peanuts-still-life-jim-golden.jpg", "thumb": "", "linkTarget": "", "caption": "packing peanuts of different varieties", "overrides": { "thumbScaleFactor": false }, "featuredImage": "", "dateAdded": "2017-11-29T22:44:19.000Z", "filters": [ "removed from overview" ], "key": "10848" }, "10849": { "id": 10849, "size": { "content": { "width": 1860, "height": 1032 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 350461 }, "label": "fabric-texture-tanktop-jockey-product-photo", "type": "image", "content": "fabric-texture-tanktop-jockey-product-photo.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:35.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10850": { "id": 10850, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 256832 }, "label": "gigi hadid outfit for reebok women", "type": "image", "content": "gigihadid-rebook-sportswear-womens-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:38.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10851": { "id": 10851, "size": { "content": { "width": 1183, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 257657 }, "label": "mens-sportswear-footwear-reebok-jimgolden", "type": "image", "content": "mens-sportswear-footwear-reebok-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:40.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10852": { "id": 10852, "size": { "content": { "width": 1860, "height": 1323 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 506244 }, "label": "menswear-fabric-detail-jockey-tabletop", "type": "image", "content": "menswear-fabric-detail-jockey-tabletop.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:42.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10853": { "id": 10853, "size": { "content": { "width": 1523, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 318163 }, "label": "mens reebok sportswear on a white court with red stripe", "type": "image", "content": "reebok-sportswear-apparel-fitness-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:45.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:38:11.766Z" }, "10854": { "id": 10854, "size": { "content": { "width": 1157, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 271298 }, "label": "support group photo of colorful sport bras reebok", "type": "image", "content": "sports-bra-reebok-sportswear-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:47.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:51:05.670Z" }, "10855": { "id": 10855, "size": { "content": { "width": 1451, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 242667 }, "label": "sportswear-fitness-apparel-footwear-jimgolden", "type": "image", "content": "sportswear-fitness-apparel-footwear-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:49.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10856": { "id": 10856, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148879 }, "label": "women's apparel hanging on racks red black white", "type": "image", "content": "sportswear-footwear-reebok-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:51.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:38:11.766Z" }, "10857": { "id": 10857, "size": { "content": { "width": 922, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144076 }, "label": "brown womens underwear in a grey background jockey", "type": "image", "content": "underwear-pattern-jimgolden-photographer.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:53.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:51:08.682Z" }, "10858": { "id": 10858, "size": { "content": { "width": 1263, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 314397 }, "label": "womens-tanktop-sportswear-reebok-jimgolden", "type": "image", "content": "womens-tanktop-sportswear-reebok-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:24:58.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10859": { "id": 10859, "size": { "content": { "width": 1096, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 268801 }, "label": "womens reebok apparel hanging from white bars", "type": "image", "content": "womenswear-sportswear-reebok-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:25:01.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10860": { "id": 10860, "size": { "content": { "width": 1102, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 251885 }, "label": "footwear-trainer-sneaker-jimgolden", "type": "image", "content": "footwear-trainer-sneaker-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:28:05.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:32:18.651Z" }, "10861": { "id": 10861, "size": { "content": { "width": 1100, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 463052 }, "label": "reebok-face-stockholm-jimgolden", "type": "image", "content": "reebok-face-stockholm-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:28:08.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:25:58.705Z" }, "10862": { "id": 10862, "size": { "content": { "width": 1523, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 427856 }, "label": "reebok-facestockholm-sneaker-jimgolden", "type": "image", "content": "reebok-facestockholm-sneaker-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:28:10.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:26:05.409Z" }, "10863": { "id": 10863, "size": { "content": { "width": 1734, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 299305 }, "label": "reebok-footwear-sportswear-hanging-jimgolden", "type": "image", "content": "reebok-footwear-sportswear-hanging-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:28:12.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [] }, "10864": { "id": 10864, "size": { "content": { "width": 862, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 245419 }, "label": "reebok-sneakers-footwear-sport-jimgolden", "type": "image", "content": "reebok-sneakers-footwear-sport-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:28:15.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:28:49.579Z" }, "10865": { "id": 10865, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 192512 }, "label": "retro reebok training footwear leather sneakers pastel colors", "type": "image", "content": "retro-footwear-reebok-training-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:28:17.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-01-30T23:44:33.791Z" }, "10866": { "id": 10866, "size": { "content": { "width": 1734, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 340598 }, "label": "classic reebok shoes hanging from their laces", "type": "image", "content": "reebok-footwear-photography-portland.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:30:27.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-01-30T23:44:33.791Z" }, "10867": { "id": 10867, "size": { "content": { "width": 863, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 183572 }, "label": "bulbs-light-colorful-red-yellow-blue-stilllife", "type": "image", "content": "bulbs-light-colorful-red-yellow-blue-stilllife.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:32:26.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-01-30T23:44:05.027Z" }, "10868": { "id": 10868, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 336082 }, "label": "dinnerware on a graphic background", "type": "image", "content": "dinnerwear-stripe-plates-still-life-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:32:29.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2022-04-18T19:40:47.502Z", "key": "10868" }, "10869": { "id": 10869, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 485579 }, "label": "fly fishing jig on a blue background", "type": "image", "content": "fieldandstream-flyfishing-stilllife-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:32:31.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-02-09T20:19:39.600Z", "key": "10869" }, "10870": { "id": 10870, "size": { "content": { "width": 970, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 273363 }, "label": "lightbulbs-stilllife-color-jimgolden", "type": "image", "content": "lightbulbs-stilllife-color-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:32:34.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-01-30T23:44:05.027Z" }, "10871": { "id": 10871, "size": { "content": { "width": 1183, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 263630 }, "label": "correlle plates and mug on blue with peaches", "type": "image", "content": "plates-mug-peach-still-life-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-04T19:32:42.000Z", "caption": "© Jim Golden 2017 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2022-04-18T19:40:40.469Z", "key": "10871", "searchable": true }, "10872": { "id": 10872, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 270209 }, "label": "reebok classics workout outfit on a peach background ", "type": "image", "content": "JS-FW16-REEBOK-RALLY-CLASSIC-LEATHER_0477.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T03:20:40.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:49:53.548Z" }, "10873": { "id": 10873, "size": { "content": { "width": 1031, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 325593 }, "label": "reebok sportswear outfit womens apparel ", "type": "image", "content": "JS-FW16-REEBOK-RALLY-PERS1_0498.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T03:20:42.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:37:34.392Z" }, "10874": { "id": 10874, "size": { "content": { "width": 1480, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261499 }, "label": "womens workout clothes on a pink background", "type": "image", "content": "JS-FW16-REEBOK-RALLY-PERS4_0854.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T03:20:45.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:37:34.392Z" }, "10875": { "id": 10875, "size": { "content": { "width": 1413, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 265647 }, "label": "workout outfit on a light blue background sneakers hoody shorts", "type": "image", "content": "JS-FW16-REEBOK-RALLY-PERS6_0821.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T03:20:47.000Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:37:34.392Z" }, "10876": { "id": 10876, "size": { "content": { "width": 861, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 254403 }, "label": "reebok classic leather footwear pattern", "type": "image", "content": "reebok-classic-leather-sneaker-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T03:40:17.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:33.791Z" }, "10877": { "id": 10877, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 133998 }, "label": "vintage reebok freestyle hi sneaker stacked up", "type": "image", "content": "reebok-vintage-sneaker-footwear-sport-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T03:40:19.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [ "removed from overview" ], "postDate": "2019-01-30T23:44:33.791Z", "key": "10877" }, "10878": { "id": 10878, "size": { "content": { "width": 1465, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193873 }, "label": "jockey sportswear hanging on wooden hangers", "type": "image", "content": "apparel-sportswear-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2017-12-05T04:05:58.000Z", "caption": "© Jim Golden 2016 ALL RIGHTS RESERVED", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:37:34.392Z" }, "10879": { "id": 10879, "size": { "content": { "width": 930, "height": 1051 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 188781 }, "label": "FootwearParisHokaOneOneRunning", "type": "image", "content": "FootwearParisHokaOneOneRunning.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2018-03-14T22:27:21.330Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "Footwear" ], "postDate": "2020-05-04T22:32:28.728Z" }, "10880": { "id": 10880, "size": { "content": { "width": 930, "height": 1062 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 208390 }, "label": "RunningShoeFootwearSportswearHoka", "type": "image", "content": "RunningShoeFootwearSportswearHoka.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2018-03-14T22:27:23.500Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "Footwear" ], "postDate": "2020-05-04T22:32:31.739Z", "key": "10880" }, "10881": { "id": 10881, "size": { "content": { "width": 2000, "height": 1538 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 3705861 }, "label": "TURNTABLE-_0071_2K_FLAT", "type": "image", "content": "TURNTABLE-_0071_2K_FLAT.gif", "thumb": "", "linkTarget": "", "dateAdded": "2018-03-14T22:36:04.881Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-02-07T19:21:53.803Z", "key": "10881" }, "10882": { "id": 10882, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "pdf builder", "type": "link", "content": "https://jimgoldenstudio.photofolio.io/pdf", "thumb": "", "linkTarget": "_blank", "dateAdded": "2019-01-28T22:12:28.810Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10882" }, "10883": { "id": 10883, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 123292 }, "label": "dragonfruit on a alpine green with yellow container", "type": "image", "content": "DRAGONFRUIT_0380.jpg", "thumb": "", "linkTarget": "", "caption": "dragonfruit on a alpine green with yellow container", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-06T00:27:08.715Z", "filters": [], "key": "10883" }, "10884": { "id": 10884, "size": { "content": { "width": 1285, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 226702 }, "label": "fresh organic ginger sculpture on a red background", "type": "image", "content": "GINGER-REDEUX_0471.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:10.455Z", "caption": "fresh organic ginger sculpture on a red background", "featuredImage": "", "overrides": {}, "filters": [] }, "10885": { "id": 10885, "size": { "content": { "width": 987, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 221773 }, "label": "kinowa melon wrapped in produce bag on purple background", "type": "image", "content": "KINOWA-MELON_0537.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:11.957Z", "caption": "kinowa melon wrapped in produce bag on purple background", "featuredImage": "", "overrides": {}, "filters": [] }, "10886": { "id": 10886, "size": { "content": { "width": 1582, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 308347 }, "label": "kinowa melon sliced to reveal the inside", "type": "image", "content": "KINOWA-MELON_0554.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:14.053Z", "caption": "kinowa melon sliced to reveal the inside", "featuredImage": "", "overrides": {}, "filters": [] }, "10887": { "id": 10887, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 192156 }, "label": "rambutan fruit on a blue glass plate pink background ", "type": "image", "content": "RAMBUTAN.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:15.751Z", "caption": "rambutan fruit on a blue glass plate", "featuredImage": "", "overrides": {}, "filters": [] }, "10888": { "id": 10888, "size": { "content": { "width": 964, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 87321 }, "label": "stack of yellow starfruit on a reflective red surface", "type": "image", "content": "STARFRUIT_0498.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:17.284Z", "caption": "stack of starfruit on a reflective red surface", "featuredImage": "", "overrides": {}, "filters": [] }, "10889": { "id": 10889, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 125101 }, "label": "delicious buddha hand on a pink and purple background", "type": "image", "content": "VEG-TEST-BUDDHAFINGER_0372.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:21.679Z", "caption": "delicious buddha hand on a pink and purple background", "featuredImage": "", "overrides": {}, "filters": [] }, "10890": { "id": 10890, "size": { "content": { "width": 1507, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219206 }, "label": "cause up image of a savoy cabbage", "type": "image", "content": "VEG-TEST-DINO-CABBAGE_0296.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:23.086Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10891": { "id": 10891, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 214723 }, "label": "close up image of rainbow chard", "type": "image", "content": "VEG-TEST-DINO-KALE_0173.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:27:24.751Z", "caption": "close up image of rainbow chard", "featuredImage": "", "overrides": {}, "filters": [] }, "10892": { "id": 10892, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186036 }, "label": "closeup rainbow chard image on a black background", "type": "image", "content": "VEG-TEST-DINO-KALE_0244.jpg", "thumb": "", "linkTarget": "", "caption": "closeup rainbow chard image on a black background", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-06T00:27:26.395Z", "filters": [] }, "10893": { "id": 10893, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 332809 }, "label": "this is romanesco, its green and tastes delicious", "type": "image", "content": "VEG-TEST-ROMANESCO_0010.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-06T00:27:28.352Z", "filters": [] }, "10894": { "id": 10894, "size": { "content": { "width": 1860, "height": 1115 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 342923 }, "label": "auto parts sculpture of a handshake that looks like robots on a light blue background", "type": "image", "content": "auto-parts-handshake-robot.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T00:56:41.593Z", "caption": "sculpture of hands shanking made of autocrats on a light green background", "featuredImage": "", "overrides": {}, "filters": [], "key": "10894", "searchable": true, "keywords": [ "still life", "sculpture", "auto parts", "silver", "red", "green", "topdown", "layflat", "thingsorganizedneatly" ] }, "10895": { "id": 10895, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 161553 }, "label": "black and white photo of stacked foam cups", "type": "image", "content": "STYRO-CUPS_0639.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:13.708Z", "caption": "black and white photo of stacked foam cups", "featuredImage": "", "overrides": {}, "filters": [], "key": "10895" }, "10896": { "id": 10896, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 51920 }, "label": "simple stack of styrofoam cups on black plexiglass ", "type": "image", "content": "STYRO-CUPS_0650.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:15.016Z", "caption": "simple stack of styrofoam cups on black plexiglass ", "featuredImage": "", "overrides": {}, "filters": [], "key": "10896" }, "10897": { "id": 10897, "size": { "content": { "width": 1136, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144436 }, "label": "white styrofoam cups in a grid pattern", "type": "image", "content": "STYRO-CUPS_0669.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:17.103Z", "caption": "white styrofoam cups in a grid pattern", "featuredImage": "", "overrides": {}, "filters": [], "key": "10897", "searchable": true, "keywords": [ "white styrofoam cups in a grid pattern" ] }, "10898": { "id": 10898, "size": { "content": { "width": 1685, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 253444 }, "label": "white and black styrofoam cups organized neatly", "type": "image", "content": "STYRO-CUPS_0710.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:19.885Z", "caption": "white and black styrofoam cups organized neatly", "featuredImage": "", "overrides": {}, "filters": [], "key": "10898" }, "10899": { "id": 10899, "size": { "content": { "width": 1435, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 192634 }, "label": "STYRO-CUPS_0716", "type": "image", "content": "STYRO-CUPS_0716.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:22.572Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10900": { "id": 10900, "size": { "content": { "width": 1484, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178678 }, "label": "stacked styrofoam cups on black plexiglass", "type": "image", "content": "STYRO-CUPS_0732.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:24.816Z", "caption": "stacked styrofoam cups on black plexiglass", "featuredImage": "", "overrides": {}, "filters": [], "key": "10900" }, "10901": { "id": 10901, "size": { "content": { "width": 861, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 136138 }, "label": "styrofoam cups in a weird pattern", "type": "image", "content": "STYRO-CUPS_0737.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:19:26.773Z", "caption": "styrofoam cups in a weird pattern", "featuredImage": "", "overrides": {}, "filters": [], "key": "10901" }, "10902": { "id": 10902, "size": { "content": { "width": 1435, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 200328 }, "label": "giant stack of foam cups", "type": "image", "content": "STYRO-CUPSx_0716.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T01:28:56.261Z", "caption": "giant stack of foam cups", "featuredImage": "", "overrides": {}, "filters": [], "key": "10902" }, "10903": { "id": 10903, "size": { "content": { "width": 906, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 224408 }, "label": "tower of power of celery and carrot sticks", "type": "image", "content": "SNACKS-CARROTS_0385-TOP.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T18:59:06.071Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10904": { "id": 10904, "size": { "content": { "width": 1529, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 320347 }, "label": "SNACKS-CRACKERS_0248-D", "type": "image", "content": "SNACKS-CRACKERS_0248-D.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T18:59:08.005Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10905": { "id": 10905, "size": { "content": { "width": 1004, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 217709 }, "label": "SNACKS-POTATOCHIPS_0028-2", "type": "image", "content": "SNACKS-POTATOCHIPS_0028-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T18:59:09.559Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10906": { "id": 10906, "size": { "content": { "width": 1860, "height": 1387 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1662371 }, "label": "saltine cracker stacks on purple background with geckos", "type": "image", "content": "SNACKS-CRACKERS_0248-ANI.gif", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T18:59:25.185Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10907": { "id": 10907, "size": { "content": { "width": 930, "height": 1056 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1649370 }, "label": "potato chips in a pyramid formation ", "type": "image", "content": "SNACKS-POTATOCHIPS_0028-2.gif", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T18:59:30.203Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10907" }, "10908": { "id": 10908, "size": { "content": { "width": 895, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 161331 }, "label": "pretzel sculptures on blue background", "type": "image", "content": "SNACKS-PRETZELS_0154.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T18:59:35.951Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10909": { "id": 10909, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144839 }, "label": "PLASTIC-BAG_0258", "type": "image", "content": "PLASTIC-BAG_0258.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T19:16:44.765Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10910": { "id": 10910, "size": { "content": { "width": 1476, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 140718 }, "label": "PLASTIC-CLAMSEHLL_0617", "type": "image", "content": "PLASTIC-CLAMSEHLL_0617.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T19:16:46.706Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10911": { "id": 10911, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196078 }, "label": "plastic saran wrap from a take out sandwich", "type": "image", "content": "PLASTIC-WRAP_0441.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T19:16:55.288Z", "caption": "plastic saran wrap from a take out sandwich", "featuredImage": "", "overrides": {}, "filters": [], "key": "10911" }, "10912": { "id": 10912, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 183107 }, "label": "PRODUCE-BAG_0443", "type": "image", "content": "PRODUCE-BAG_0443.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T19:16:56.817Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10913": { "id": 10913, "size": { "content": { "width": 837, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 320340 }, "label": "bait fishing gear on a red picnic table classic summer fun", "type": "image", "content": "fieldandstream-bait-fishing.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T20:47:54.823Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10913" }, "10914": { "id": 10914, "size": { "content": { "width": 824, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 305637 }, "label": "dog training gear in the back of a vintage blue pickup truck", "type": "image", "content": "fieldandstream-dog-training.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T20:47:56.443Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10914" }, "10915": { "id": 10915, "size": { "content": { "width": 839, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 343727 }, "label": "classic fly fishing gear in the bottom of a canoe summer fun", "type": "image", "content": "fieldandstream-flyfishing.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T20:47:58.114Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10915" }, "10916": { "id": 10916, "size": { "content": { "width": 1737, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 258260 }, "label": "fieldandstream-streamer-fly-fishing", "type": "image", "content": "fieldandstream-streamer-fly-fishing.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T20:47:59.754Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10917": { "id": 10917, "size": { "content": { "width": 930, "height": 957 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219686 }, "label": "fieldsandstream-bow-hunt-story", "type": "image", "content": "fieldsandstream-bow-hunt-story.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T20:56:31.351Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10918": { "id": 10918, "size": { "content": { "width": 930, "height": 1010 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 116824 }, "label": "fieldsandstream-hunting-story", "type": "image", "content": "fieldsandstream-hunting-story.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-06T20:56:34.555Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10919": { "id": 10919, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 524275 }, "label": "yellow bubble wrap on a black background", "type": "image", "content": "bubble-wrap-jim-golden-still-life2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T00:32:17.937Z", "caption": "yellow bubble wrap on a black background", "featuredImage": "", "overrides": {}, "filters": [], "key": "10919" }, "10920": { "id": 10920, "size": { "content": { "width": 885, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148357 }, "label": "large bubble wrap on dark background", "type": "image", "content": "bubble-wrap.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T01:13:20.487Z", "caption": "large bubble wrap on dark background", "featuredImage": "", "overrides": {}, "filters": [], "key": "10920" }, "10921": { "id": 10921, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219258 }, "label": "baking holiday cookies with kids", "type": "image", "content": "NSM_DecemberTogether_Hands-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T01:25:44.141Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10921" }, "10922": { "id": 10922, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 211001 }, "label": "bacon in a cast iron pan with brussel sprouts", "type": "image", "content": "NSM_NovemberTogether4-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T01:25:45.797Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10922" }, "10923": { "id": 10923, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174166 }, "label": "football is better with a turkey sandwich", "type": "image", "content": "NSM_NovemberTogether4-6.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T01:25:47.226Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10923" }, "10924": { "id": 10924, "size": { "content": { "width": 1482, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 191410 }, "label": "adidas Springblade_running shoe in futuristic background", "type": "image", "content": "SS14_Run_PR_Springblade_FW_M_Single.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T01:32:25.277Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:25:27.510Z", "key": "10924", "searchable": true }, "10925": { "id": 10925, "size": { "content": { "width": 869, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 122232 }, "label": "hoka clifton one tasty ride NYC", "type": "image", "content": "HOKA_Clifton3_MM_NYC_Womens.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T19:16:03.162Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10925", "postDate": "2021-09-09T19:06:35.336Z" }, "10926": { "id": 10926, "size": { "content": { "width": 1000, "height": 750 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 934475 }, "label": "kids sandwich with fruit and veggies", "type": "image", "content": "HUB-SODEXO-FOOD3_0133-A.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-07T20:06:55.523Z", "filters": [], "key": "10926" }, "10927": { "id": 10927, "size": { "content": { "width": 762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 308721 }, "label": "fruit and vegetables from a portland farmers market", "type": "image", "content": "farmers-market-portland-oregon.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T20:10:46.644Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T19:56:08.681Z", "key": "10927" }, "10928": { "id": 10928, "size": { "content": { "width": 1113, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 268854 }, "label": "salad vegetables arrange in a round mandala", "type": "image", "content": "salad-veggies-mandala.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T20:11:06.163Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-02-08T00:32:09.091Z" }, "10929": { "id": 10929, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 44541 }, "label": "dark-mushroom", "type": "image", "content": "dark-mushroom.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T22:03:07.540Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10930": { "id": 10930, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 41738 }, "label": "oyster-mushroom-clump", "type": "image", "content": "oyster-mushroom-clump.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2019-02-07T22:03:15.305Z", "filters": [], "key": "10930" }, "10931": { "id": 10931, "size": { "content": { "width": 855, "height": 943 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 55133 }, "label": "dark oyster mushroom photo on black", "type": "image", "content": "oyster-mushroom.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T22:03:16.839Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10932": { "id": 10932, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 61891 }, "label": "clump of oyster mushrooms that is dark", "type": "image", "content": "oyster-mushroom-clump2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T22:08:38.176Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T18:56:51.701Z" }, "10933": { "id": 10933, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 360996 }, "label": "animation of a chainsaw on a black background", "type": "image", "content": "Chainsaw-Still-Life.gif", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T22:42:26.883Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T18:56:38.705Z" }, "10934": { "id": 10934, "size": { "content": { "width": 1482, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1686964 }, "label": "animation of a vintage technics turntable", "type": "image", "content": "TURNTABLE-ANI.gif", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T23:31:06.049Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T18:56:38.705Z" }, "10935": { "id": 10935, "size": { "content": { "width": 927, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 67748 }, "label": "dark-mushroom-jimgolden", "type": "image", "content": "dark-mushroom-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T23:38:42.699Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10936": { "id": 10936, "size": { "content": { "width": 813, "height": 1000 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 58090 }, "label": "dark mushroom photo", "type": "image", "content": "dark-mushroom-jimgoldenstudio.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-07T23:39:43.442Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T18:56:47.405Z" }, "10937": { "id": 10937, "size": { "content": { "width": 1476, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 138542 }, "label": "plastic clamshell for take out food arraign in a circular stack", "type": "image", "content": "plastic-clamshell-hidden-oil.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:24:57.844Z", "caption": "plastic clamshell for take out food arraign in a circular stack", "featuredImage": "", "overrides": {}, "filters": [], "key": "10937" }, "10938": { "id": 10938, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 262350 }, "label": "cooking utensils arranged in a mandala", "type": "image", "content": "HUB-SODEXO-2-UTENSIL-MANDALA_0133.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-08T00:39:30.311Z", "filters": [], "postDate": "2020-11-11T18:24:11.872Z" }, "10939": { "id": 10939, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 346097 }, "label": "healthy school lunches with fruit and veggies", "type": "image", "content": "healthy-school-lunch.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:46:05.417Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10940": { "id": 10940, "size": { "content": { "width": 1621, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 280844 }, "label": "black nike footwear and apparel on a black and gold background", "type": "image", "content": "nike-black-friday-sportswear-footwear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:53:36.036Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:55:32.898Z" }, "10941": { "id": 10941, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108583 }, "label": "nike golf apparel on white grey camp background", "type": "image", "content": "nike-golf-apparel.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:54:05.045Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:37:34.392Z" }, "10942": { "id": 10942, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 91558 }, "label": "nike-golf-sportswear", "type": "image", "content": "nike-golf-sportswear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:54:06.768Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10943": { "id": 10943, "size": { "content": { "width": 1860, "height": 947 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 481041 }, "label": "nike-court-1", "type": "image", "content": "nike-court-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:54:26.826Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10944": { "id": 10944, "size": { "content": { "width": 1860, "height": 939 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 570615 }, "label": "nike tennis footwear cause a racket", "type": "image", "content": "nike-tennis-shoes-footwear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T00:56:58.077Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:34:06.507Z" }, "10945": { "id": 10945, "size": { "content": { "width": 1081, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 175704 }, "label": "reebok training sneakers reflective black background ", "type": "image", "content": "reebok-footwear-sportswear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T17:46:33.136Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-05-04T22:25:20.815Z" }, "10946": { "id": 10946, "size": { "content": { "width": 1594, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 304191 }, "label": "women sportswear apparel on colorful plexiglass", "type": "image", "content": "womens-apparel-photography-jim-golden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T18:34:02.799Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10947": { "id": 10947, "size": { "content": { "width": 1654, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 259646 }, "label": "reebok sportswear and footwear on a tennis court", "type": "image", "content": "reebok-sportswear-photogrpahy.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T18:34:10.384Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10947" }, "10948": { "id": 10948, "size": { "content": { "width": 857, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 163486 }, "label": "field and stream magazine cooler shootout", "type": "image", "content": "field-and-stream-cooler-shootout.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T18:42:18.516Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10949": { "id": 10949, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 307160 }, "label": "benchmade knife company laser and steel catalog cover", "type": "image", "content": "benchmade-catalog-cover-photo.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T19:35:19.716Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10949", "postDate": "2023-02-21T20:45:21.318Z" }, "10950": { "id": 10950, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 604548 }, "label": "benchmade-knife-edc", "type": "image", "content": "benchmade-knife-edc.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T19:35:27.264Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10951": { "id": 10951, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 169156 }, "label": "fancy-knife-still-life", "type": "image", "content": "fancy-knife-still-life.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T19:35:30.099Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10952": { "id": 10952, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 358000 }, "label": "hunting-knifephtoo", "type": "image", "content": "hunting-knifephtoo.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T19:35:34.796Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10953": { "id": 10953, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 113363 }, "label": "tactical-still-life-photography", "type": "image", "content": "tactical-still-life-photography.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-08T19:35:36.296Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10954": { "id": 10954, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 187765 }, "label": "plates on a yellow black and white polka dot table with watermelon ", "type": "image", "content": "F8-CORELLE-TEST-PATTERN-SOFT_0631.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-09T22:02:13.317Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10954", "searchable": true }, "10955": { "id": 10955, "searchable": true, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84565 }, "label": "odd stack of plates and cups", "type": "image", "content": "F8-CORELLE-TEST-STACK_0673.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-02-09T22:02:15.523Z", "filters": [] }, "10956": { "id": 10956, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 152633 }, "label": "whole-foods-produce-bag", "type": "image", "content": "whole-foods-produce-bag.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-11T00:52:27.945Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10957": { "id": 10957, "size": { "content": { "width": 1241, "height": 930 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 224085 }, "label": "green produce bag from whole foods market", "type": "image", "content": "whole-foods-produce-bag-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-11T00:54:19.998Z", "caption": "green produce bag from whole foods market", "featuredImage": "", "overrides": {}, "filters": [], "key": "10957" }, "10958": { "id": 10958, "size": { "content": { "width": 1448, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 296238 }, "label": "bread-collection", "type": "image", "content": "bread-collection.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-18T19:40:07.589Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10959": { "id": 10959, "size": { "content": { "width": 1448, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 300594 }, "label": "variety of crusty artisanal breads in a rectangle", "type": "image", "content": "BREAD-COLLECTIONx.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-02-18T19:42:26.331Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10959", "postDate": "2020-05-04T22:46:56.036Z" }, "10960": { "id": 10960, "size": { "content": { "width": 1099, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 177743 }, "label": "hand foot X-ray on orange and yellow background with outdoor stuff around it", "type": "image", "content": "fieldandstream-ignore-the-X-Ray.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:18:34.343Z", "filters": [], "key": "10960" }, "10961": { "id": 10961, "size": { "content": { "width": 1137, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 187402 }, "label": "clay pigeon with fuse on green and blue background exploding target", "type": "image", "content": "fieldandstream-exploding-Target.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:18:36.275Z", "filters": [] }, "10962": { "id": 10962, "size": { "content": { "width": 1603, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 432556 }, "label": "all the stuff to have fun this summer on yellow background", "type": "image", "content": "fieldandstream-summer-2019-Opener.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:18:38.110Z", "filters": [], "key": "10962" }, "10963": { "id": 10963, "size": { "content": { "width": 1018, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 245975 }, "label": "binoculars compass canteen antler on blue and yellow background", "type": "image", "content": "fieldandstream-kids-Backyard-Quest.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:18:39.636Z", "filters": [], "key": "10963" }, "10964": { "id": 10964, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 259420 }, "label": "fieldandstream-encyclopedia-of-summer-2019-Cover", "type": "image", "content": "fieldandstream-encyclopedia-of-summer-2019-Cover.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-09T00:18:50.055Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10965": { "id": 10965, "size": { "content": { "width": 987, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84620 }, "label": "moody artichoke on a black background dramatic", "type": "image", "content": "moody-artichoke-profile-on-black.jpg", "thumb": "", "linkTarget": "", "caption": "moody artichoke on a black background dramatic", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:23:05.643Z", "filters": [], "key": "10965" }, "10966": { "id": 10966, "size": { "content": { "width": 949, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 100331 }, "label": "dramatic photo of book ahoy on black background", "type": "image", "content": "bok-choy-on-black.jpg", "thumb": "", "linkTarget": "", "caption": "dramatic photo of book ahoy on black background", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:23:06.879Z", "filters": [], "key": "10966" }, "10967": { "id": 10967, "size": { "content": { "width": 1209, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 184785 }, "label": "dramatic stalk of broccoli on a black background", "type": "image", "content": "moody-broccoli-on-black.jpg", "thumb": "", "linkTarget": "", "caption": "dramatic stalk of broccoli on a black background", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:23:08.537Z", "filters": [], "key": "10967" }, "10968": { "id": 10968, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198001 }, "label": "head of green cabbage that looks like a brain with dramatic lighting", "type": "image", "content": "green-cabbage-as-brain.jpg", "thumb": "", "linkTarget": "", "caption": "head of green cabbage that looks like a brain with dramatic lighting", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:23:10.056Z", "filters": [], "key": "10968" }, "10969": { "id": 10969, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 418111 }, "label": "macro image of backlit leaf of green cabbage", "type": "image", "content": "green-cabbage-veins.jpg", "thumb": "", "linkTarget": "", "caption": "backlit leaf of green cabbage", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-09T00:23:11.935Z", "filters": [], "key": "10969" }, "10970": { "id": 10970, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 103824 }, "label": "moody photo of rhubarb stalks on black", "type": "image", "content": "rhubarb-stalks.jpg", "thumb": "", "linkTarget": "", "caption": "moody photo of rhubarb stalks on black", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-18T20:53:49.240Z", "filters": [], "key": "10970" }, "10971": { "id": 10971, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 160155 }, "label": "colorful moody photo of rainbow chard leaf", "type": "image", "content": "rainbow-chard.jpg", "thumb": "", "linkTarget": "", "caption": "colorful moody photo of rainbow chard leaf", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-18T20:53:50.619Z", "filters": [], "key": "10971" }, "10972": { "id": 10972, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101254 }, "label": "bunch if orange carrots with greens attached on black", "type": "image", "content": "carrots-with-greens.jpg", "thumb": "", "linkTarget": "", "caption": "bunch if orange carrots with greens attached on black", "overrides": {}, "featuredImage": "", "dateAdded": "2019-07-18T20:53:51.949Z", "filters": [], "key": "10972" }, "10973": { "id": 10973, "size": { "content": { "width": 1738, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 212956 }, "label": "reebok-summery", "type": "image", "content": "reebok-summery.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:22.350Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:49:19.898Z" }, "10974": { "id": 10974, "size": { "content": { "width": 950, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 153144 }, "label": "reebok-flying-jacket", "type": "image", "content": "reebok-flying-jacket.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:24.265Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:49:19.898Z" }, "10975": { "id": 10975, "size": { "content": { "width": 1081, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 180936 }, "label": "reebok-footwear", "type": "image", "content": "reebok-footwear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:25.707Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2019-07-21T18:49:19.898Z" }, "10976": { "id": 10976, "size": { "content": { "width": 1222, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 200406 }, "label": "modcloth-purses-sandals", "type": "image", "content": "modcloth-purses-sandals.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:27.169Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2023-02-21T20:13:26.320Z" }, "10977": { "id": 10977, "size": { "content": { "width": 1108, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 302033 }, "label": "modcloth-wknd-getaway", "type": "image", "content": "modcloth-wknd-getaway.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:28.898Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2023-02-21T20:13:26.320Z" }, "10978": { "id": 10978, "size": { "content": { "width": 1040, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 187685 }, "label": "modcloth-clogs", "type": "image", "content": "modcloth-clogs.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:30.278Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2023-02-21T20:13:26.320Z" }, "10979": { "id": 10979, "size": { "content": { "width": 891, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 201265 }, "label": "modcloth-lemon-kush", "type": "image", "content": "modcloth-lemon-kush.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:47:31.622Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2023-02-21T20:13:26.320Z", "key": "10979" }, "10980": { "id": 10980, "size": { "content": { "width": 1841, "height": 974 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 359585 }, "label": "nike-court-2", "type": "image", "content": "nike-court-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-07-21T18:59:17.617Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10984": { "id": 10984, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Hoka Arahi 2", "type": "video", "content": "vimeo:377654684", "thumb": "", "linkTarget": "", "dateAdded": "2019-12-05T22:01:19.558Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10985": { "id": 10985, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 315448 }, "label": "vintage reel to reel collection image on a green background for apple shot on iPhone", "type": "image", "content": "REEL-TO-REEL-COLLECTION-JIMGOLDEN.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-12-05T22:23:34.875Z", "caption": "vintage reel to reel collection image on a green background for apple shot on iPhone", "featuredImage": "", "overrides": {}, "filters": [], "key": "10985", "keywords": [ "apple", "shot on iPhone", "tape players", "reel to reel", "still life", "knolling", "things organized neatly" ], "searchable": true }, "10986": { "id": 10986, "size": { "content": { "width": 1249, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 371225 }, "label": "nike sneaker collection artfully arranged neatly on a light blue background", "type": "image", "content": "NIKE-COLLECTION-JIMGOLDEN.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2019-12-05T22:23:36.192Z", "caption": "nike sneaker collection artfully arranged neatly on a light blue background", "featuredImage": "", "overrides": {}, "filters": [], "keywords": [ "apple", "shot on iPhone", "nike", "shoes", "runners", "trainer", "still life", "knolling", "things organized neatly" ], "searchable": true }, "10987": { "id": 10987, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 501, "height": 896 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Laydown photography with Jim Golden shoot film for apple shot on iphone", "type": "video", "content": "vimeo:377659866", "thumb": "aplleIGTVbadge.jpg", "linkTarget": "", "dateAdded": "2019-12-05T22:31:47.335Z", "caption": "Laydown photography with Jim Golden shoot film for apple shot on iphone", "featuredImage": "", "overrides": {}, "filters": [] }, "10988": { "id": 10988, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 165298 }, "label": "nike basketball lebron james air trainer 16 inspired by bo jackson multi sport athlete", "type": "image", "content": "Nike-basketball-lebron-airtrainer-16.jpg", "thumb": "", "linkTarget": "", "caption": "nike basketball lebron james air trainer 16 inspired by bo jackson multi sport athlete", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:27:42.257Z", "filters": [], "key": "10988", "keywords": [ "nike", "lebron", "cross trainer", "sneaker", "shoe", "trainer", "just do it", "still life", "sculpture" ], "searchable": true }, "10989": { "id": 10989, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 757072 }, "label": "nike space hippie trainer on a bed of flowers with light rays", "type": "image", "content": "nike-space-hippie-footwear-sneaker.jpg", "thumb": "", "linkTarget": "", "caption": "nike-space-hippie-footwear-sneaker move to zero sustainable green", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:40:14.019Z", "filters": [] }, "10990": { "id": 10990, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 638802 }, "label": "nike space hippie trainer on a bed of flowers with light rays", "type": "image", "content": "nike-footwear-sustainable-green-move-to-zero.jpg", "thumb": "", "linkTarget": "", "caption": "nike-footwear-sustainable-green-move-to-zero space hippie", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:40:18.174Z", "filters": [], "key": "10990" }, "10991": { "id": 10991, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174993 }, "label": "Nike_MajorLeagueBaseball-NATIONALS", "type": "image", "content": "Nike_MajorLeagueBaseball-NATIONALS.jpg", "thumb": "", "linkTarget": "", "caption": "Washington Nationals jersey on an maroon background for Nike MLB 2020", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:45:19.856Z", "filters": [], "key": "10991" }, "10992": { "id": 10992, "size": { "content": { "width": 1596, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 331564 }, "label": "Nike_MajorLeagueBaseball-team-jerseys-grid-2020", "type": "image", "content": "Nike_MajorLeagueBaseball-teams.jpg", "thumb": "", "linkTarget": "", "caption": "colorful image of every major league baseball team arranged in a grid for nike", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:45:22.762Z", "filters": [], "key": "10992" }, "10993": { "id": 10993, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 224839 }, "label": "Nike_MajorLeagueBaseball-YANKEES", "type": "image", "content": "Nike_MajorLeagueBaseball-YANKEES.jpg", "thumb": "", "linkTarget": "", "caption": "New Yrok Yankees jersey on a navy background for Nike MLB 2020", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:45:24.715Z", "filters": [], "key": "10993" }, "10994": { "id": 10994, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186203 }, "label": "Nike_Jerseys_MajorLeagueBaseball2020-2021_GIANTS-0374", "type": "image", "content": "NikeNews_Jerseys_MajorLeagueBaseball2020-2021_GIANTS-0374.jpg", "thumb": "", "linkTarget": "", "caption": "San Fransisco Giants jersey on an orange background for Nike MLB 2020", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:45:26.799Z", "filters": [], "key": "10994" }, "10995": { "id": 10995, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 185666 }, "label": "Nike_Jerseys_MajorLeagueBaseball2020-2021_PIRATES-0311", "type": "image", "content": "NikeNews_Jerseys_MajorLeagueBaseball2020-2021_PIRATES-0311.jpg", "thumb": "", "linkTarget": "", "caption": "pittsburgh pirates jersey for 2020 nike MLB ", "overrides": {}, "featuredImage": "", "dateAdded": "2020-02-19T20:46:15.995Z", "filters": [], "key": "10995" }, "10996": { "id": 10996, "size": { "content": { "width": 1737, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 190884 }, "label": "nike-sneaker-on-black", "type": "image", "content": "nike-sneaker-on-black.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-02-19T22:02:28.014Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10997": { "id": 10997, "size": { "content": { "width": 1737, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 240228 }, "label": "nike-vaporfly-prototype", "type": "image", "content": "nike-vaporfly-prototype.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-02-19T22:02:29.906Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "10997" }, "10998": { "id": 10998, "size": { "content": { "width": 1737, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 98012 }, "label": "nike-vaportfly-prototype-dark", "type": "image", "content": "nike-vaportfly-prototype-dark.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-02-19T22:02:31.388Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "10999": { "id": 10999, "size": { "content": { "width": 1737, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 250552 }, "label": "nike-sneaker-on-black-footwear-proto", "type": "image", "content": "nike-sneaker-on-black-footwear-proto.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-02-19T22:06:15.579Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11002": { "id": 11002, "size": { "content": { "width": 1561, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 3969951 }, "label": "HOKA-TORRENT-ANI.FLAT", "type": "image", "content": "HOKA-TORRENT-ANI.FLAT.gif", "thumb": "", "linkTarget": "", "dateAdded": "2020-05-04T21:32:44.614Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11003": { "id": 11003, "size": { "content": { "width": 1561, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 3969951 }, "label": "HOKA-TORRENT-ANI.FLAT", "type": "image", "content": "HOKA-TORRENT-ANI.FLAT.gif", "thumb": "", "linkTarget": "", "dateAdded": "2020-05-04T21:32:56.564Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-02T23:21:38.655Z" }, "11004": { "id": 11004, "searchable": true, "keywords": [ "white", "cover", "ann sacks", "made magazine", "neutrals", "tile" ], "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 142040 }, "label": "white on white ceramic tiles arranged for the cover of ann sacks MADE magazine", "type": "image", "content": "ann-sacks-made-magazine-cover_2019.jpg", "thumb": "", "linkTarget": "", "caption": "white on white ceramic tiles arranged for the cover of ann sacks MADE magazine", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T18:48:09.292Z", "filters": [] }, "11005": { "id": 11005, "size": { "content": { "width": 881, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269528 }, "label": "cover of MADE by ann sacks consisting of an overlapping pattern of colorful tiles imperfectly arranged", "type": "image", "content": "ann-sacks-tiles-magazine-cover.jpg", "thumb": "", "linkTarget": "", "caption": "cover of MADE by ann sacks consisting of an overlapping pattern of colorful tiles imperfectly arranged\n", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T18:48:11.441Z", "filters": [], "key": "11005", "keywords": [ "colorful", "grid", "tile", "ann sacks" ], "searchable": true }, "11006": { "id": 11006, "size": { "content": { "width": 1336, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 118654 }, "label": "collection of pastel colored ann sacks tiles arranged as a gradient grid", "type": "image", "content": "ann-sacks-pastel-tiles-jimgolden.jpg", "thumb": "", "linkTarget": "", "caption": "collection of pastel colored ann sacks tiles arranged as a gradient grid", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T18:48:12.910Z", "filters": [], "keywords": [ "grid", "gradient", "tile", "pastels", "warm", "colorful" ], "searchable": true }, "11007": { "id": 11007, "searchable": true, "keywords": [ "grid", "collection", "ann sacks", "tile", "graph" ], "size": { "content": { "width": 1202, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 204090 }, "label": "gridded collection of pastel colored ceramic tiles with dainty objects upon them Ann sacks tile", "type": "image", "content": "collection-of-objects-on-tiles-jimgolden-annsacks.jpg", "thumb": "", "linkTarget": "", "caption": "gridded collection of pastel colored ceramic tiles with dainty objects upon them", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T18:48:14.660Z", "filters": [] }, "11008": { "id": 11008, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 287475 }, "label": "messy pile of colorful ann sack tiles red blue green maroon", "type": "image", "content": "jimgolden-annsacks-colored-tiles.jpg", "thumb": "", "linkTarget": "", "caption": "messy pile of colorful ann sack tiles red blue green maroon", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T18:48:16.546Z", "filters": [], "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor" ], "searchable": true }, "11009": { "id": 11009, "size": { "content": { "width": 910, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 279541 }, "label": "small objects arranged on a dark tile collection for ann sacks tiles", "type": "image", "content": "knolling-objects-annsacks-jimgolden.jpg", "thumb": "", "linkTarget": "", "caption": "small objects arranged on a dark tile collection for ann sacks tiles", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T18:48:18.129Z", "filters": [], "keywords": [ "colorful", "tile", "grid", "ann sacks", "interior", "bathroom" ], "searchable": true }, "11012": { "id": 11012, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 268031 }, "label": "hard and soft goods collection for serra modern druggist on mustard yellow background", "type": "image", "content": "SERRA-LA-CAPSULE-COLLECTION-crop.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T19:50:19.136Z", "filters": [], "key": "11012", "postDate": "2022-04-18T20:58:53.402Z" }, "11013": { "id": 11013, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "email ", "type": "link", "content": "mailto:jim@jimgoldenstudio.com", "thumb": "", "linkTarget": "_blank", "dateAdded": "2020-06-02T20:14:17.087Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "Footer Links" ] }, "11014": { "id": 11014, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "jim@jimgoldenstudio.com", "type": "link", "content": "mailto: jim@jimgoldenstudio.com", "thumb": "", "linkTarget": "_blank", "dateAdded": "2020-06-02T21:51:08.688Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [ "Footer Links" ], "key": "11014" }, "11015": { "id": 11015, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "test", "type": "link", "content": "mailto: jim@jimgoldenstudio.com", "thumb": "", "linkTarget": "_blank", "dateAdded": "2020-06-02T21:54:19.251Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11017": { "id": 11017, "searchable": true, "keywords": [ "footwear", "running", "outdoor", "animation", "stopmotion", "sportswear", "shoe", "trainer", "stormy", "northwest", "wet" ], "size": { "content": { "width": 1200, "height": 674 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 7667969 }, "label": "hiking shoe with a rain forcefield stays dry during a storm", "type": "image", "content": "HOKA-CHALLENGER-MID-1200.gif", "thumb": "", "linkTarget": "", "caption": "hiking shoe with a rain forcefield keeps wetness out", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T23:17:59.770Z", "filters": [] }, "11018": { "id": 11018, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 729048 }, "label": "HOKA_TT_CH1_Product_Arahi_4_M", "type": "image", "content": "HOKA_TT_CH1_Product_Arahi_4_M.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-02T23:19:57.496Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11019": { "id": 11019, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 492390 }, "label": "HOKA_TT_CH1_Product_Challenger_MidGTX_W", "type": "image", "content": "HOKA_TT_CH1_Product_Challenger_MidGTX_W.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-02T23:19:59.591Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11020": { "id": 11020, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 608722 }, "label": "HOKA_TT_CH1_Product_Speedgoat_4_M", "type": "image", "content": "HOKA_TT_CH1_Product_Speedgoat_4_M.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-02T23:20:01.900Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11021": { "id": 11021, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 205009 }, "label": "HOKA_TT_CH2_Product_Cavu3_M", "type": "image", "content": "HOKA_TT_CH2_Product_Cavu3_M.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-02T23:20:03.555Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11022": { "id": 11022, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 251837 }, "label": "HOKA_TT_CH2_Product_Mach3_M", "type": "image", "content": "HOKA_TT_CH2_Product_Mach3_M.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-02T23:20:04.971Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11023": { "id": 11023, "size": { "content": { "width": 1200, "height": 675 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 11135277 }, "label": "trail running shoe striding through the desert", "type": "image", "content": "HOKA-SS-20-2-SG4-ANI.HORIZ.V2.gif", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-02T23:30:02.646Z", "caption": "trail running shoe striding through the desert", "featuredImage": "", "overrides": {}, "filters": [], "key": "11023", "keywords": [ "footwear", "running", "outdoor", "animation", "stopmotion", "sportswear", "shoe", "trainer" ], "searchable": true }, "11024": { "id": 11024, "searchable": true, "keywords": [ "footwear", "running", "outdoor", "animation", "stopmotion", "sportswear", "shoe", "trainer", "roadrunner", "desert" ], "size": { "content": { "width": 1200, "height": 675 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4220731 }, "label": "trail running shoe as roadrunner in the american southwest", "type": "image", "content": "HOKA-TORRENT-ANI.1920x1080.FLAT.gif", "thumb": "", "linkTarget": "", "caption": "trail running shoe as roadrunner in the american southwest", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T23:35:56.761Z", "filters": [] }, "11025": { "id": 11025, "searchable": true, "keywords": [ "footwear", "running", "outdoor", "animation", "stopmotion", "sportswear", "shoe", "trainer", "drag racing", "racing", "pace setter" ], "size": { "content": { "width": 1200, "height": 674 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 6701632 }, "label": "running shoe as a drag racer doing a burnout with a pink sky", "type": "image", "content": "HOKA-SP20-MACH-M-ANI.HORIZ.gif", "thumb": "", "linkTarget": "", "caption": "running shoe as a drag racer doing a burnout with a pink sky", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-02T23:46:13.927Z", "filters": [] }, "11026": { "id": 11026, "size": { "content": { "width": 1200, "height": 675 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 10226383 }, "label": "athletic shoe running continuously on a country road", "type": "image", "content": "HOKA-ARAHI-2-WMNS-1200px.gif", "thumb": "", "linkTarget": "", "caption": "athletic shoe running continuously on a country road", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-03T02:09:42.307Z", "filters": [], "key": "11026", "keywords": [ "footwear", "running", "outdoor", "animation", "stopmotion", "sportswear", "shoe", "trainer" ], "searchable": true }, "11027": { "id": 11027, "size": { "content": { "width": 1200, "height": 675 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 2735953 }, "label": "light as a feather pink running shoe floating on a great background", "type": "image", "content": "HOKA-SP20-CAVU-W-ANI.HORIZ.gif", "thumb": "", "linkTarget": "", "caption": "light as a feather pink running shoe floating on a great background", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-03T02:10:27.368Z", "filters": [], "key": "11027", "keywords": [ "footwear", "running", "studio", "animation", "stopmotion", "sportswear", "shoe", "trainer", "feather" ], "searchable": true }, "11028": { "id": 11028, "size": { "content": { "width": 1521, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 206146 }, "label": "TII-COMP", "type": "image", "content": "TII-COMP.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-06-03T02:54:55.658Z", "filters": [], "key": "11028" }, "11029": { "id": 11029, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 84932 }, "label": "GOLDEN-TII-WHISKEY-104", "type": "image", "content": "GOLDEN-TII-WHISKEY-104.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:03.722Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11030": { "id": 11030, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174987 }, "label": "GOLDEN-TII-RUNNING-SHOE-047", "type": "image", "content": "GOLDEN-TII-RUNNING-SHOE-047.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:06.183Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11031": { "id": 11031, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 179735 }, "label": "GOLDEN-TII-POPCORN-042", "type": "image", "content": "GOLDEN-TII-POPCORN-042.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:23.282Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11032": { "id": 11032, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 81595 }, "label": "GOLDEN-TII-NC-HEADPHONES-069", "type": "image", "content": "GOLDEN-TII-NC-HEADPHONES-069.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:24.754Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11033": { "id": 11033, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 91045 }, "label": "GOLDEN-TII-MASK-019", "type": "image", "content": "GOLDEN-TII-MASK-019.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:26.306Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11034": { "id": 11034, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 121899 }, "label": "GOLDEN-TII-KINDLE-084", "type": "image", "content": "GOLDEN-TII-KINDLE-084.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:27.851Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11035": { "id": 11035, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 178535 }, "label": "GOLDEN-TII-GLOVES-127", "type": "image", "content": "GOLDEN-TII-GLOVES-127.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:29.289Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11036": { "id": 11036, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 96214 }, "label": "GOLDEN-TII-GANJA-100", "type": "image", "content": "GOLDEN-TII-GANJA-100.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:32.298Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11037": { "id": 11037, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 119237 }, "label": "GOLDEN-TII-CIIRS-032", "type": "image", "content": "GOLDEN-TII-CIIRS-032.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:46.239Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11038": { "id": 11038, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150339 }, "label": "GOLDEN-TII-GAMING-055", "type": "image", "content": "GOLDEN-TII-GAMING-055.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:48.280Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11039": { "id": 11039, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 157603 }, "label": "GOLDEN-TII-CAMERA-076", "type": "image", "content": "GOLDEN-TII-CAMERA-076.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:49.694Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11040": { "id": 11040, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 225672 }, "label": "GOLDEN-TII-BREAD-117", "type": "image", "content": "GOLDEN-TII-BREAD-117.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T02:55:51.360Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11040" }, "11041": { "id": 11041, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 135441 }, "label": "LEAVES-TEST-232_1", "type": "image", "content": "LEAVES-TEST-232_1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:26.258Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11042": { "id": 11042, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 140498 }, "label": "LEAVES-COMP-ANGEL-803", "type": "image", "content": "LEAVES-COMP-ANGEL-803.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:28.755Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11043": { "id": 11043, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 153473 }, "label": "LEAVES-TEST-377_1", "type": "image", "content": "LEAVES-TEST-377_1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:37.400Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z", "key": "11043" }, "11044": { "id": 11044, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196113 }, "label": "LEAVES-TEST-353_1", "type": "image", "content": "LEAVES-TEST-353_1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:39.165Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11045": { "id": 11045, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 124811 }, "label": "LEAVES-TEST-311-2", "type": "image", "content": "LEAVES-TEST-311-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:41.272Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11046": { "id": 11046, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 220409 }, "label": "LEAVES-TEST-295", "type": "image", "content": "LEAVES-TEST-295.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:42.869Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11047": { "id": 11047, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 120655 }, "label": "LEAVES-TEST-266", "type": "image", "content": "LEAVES-TEST-266.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:44.436Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11048": { "id": 11048, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 209922 }, "label": "LEAVES-TEST-217", "type": "image", "content": "LEAVES-TEST-217.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:09:46.278Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11049": { "id": 11049, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 247697 }, "label": "LEAVES-COMP-886", "type": "image", "content": "LEAVES-COMP-886.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-06-03T04:10:07.037Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2020-06-03T04:10:57.555Z" }, "11052": { "id": 11052, "searchable": true, "keywords": [ "still life", "sets", "tiny", "colorful", "mini", "scale model", "cars", "trucks", "miniature" ], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 260058 }, "label": "land-rover-off-road-truck", "type": "image", "content": "land-rover-off-road-truck.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T22:20:50.849Z", "filters": [] }, "11054": { "id": 11054, "searchable": true, "keywords": [ "still life", "sets", "tiny", "colorful", "mini", "scale model", "cars", "trucks", "miniature" ], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 177963 }, "label": "jeep-comanche-desert-automotive", "type": "image", "content": "jeep-comanche-desert-automotive.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T22:20:54.159Z", "filters": [] }, "11055": { "id": 11055, "size": { "content": { "width": 1780, "height": 989 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 265729 }, "keywords": [], "label": "ice-cream-truck-in-philly", "type": "image", "content": "ice-cream-truck-in-philly.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-10-30T22:33:18.187Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11056": { "id": 11056, "size": { "content": { "width": 1645, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 238822 }, "keywords": [], "label": "volkswagen-van-camping-summer", "type": "image", "content": "volkswagen-van-camping-summer.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-10-30T22:33:24.957Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11057": { "id": 11057, "size": { "content": { "width": 1860, "height": 988 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 281546 }, "keywords": [], "label": "citroen-DS-automotive-cars", "type": "image", "content": "citroen-DS-automotive-cars.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-10-30T22:33:34.440Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11058": { "id": 11058, "searchable": true, "keywords": [ "still life", "sets", "tiny", "colorful", "mini", "scale model", "cars", "trucks", "miniature" ], "size": { "content": { "width": 1780, "height": 989 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 265729 }, "label": "ice-cream-truck-in-philly-jimgolden", "type": "image", "content": "ice-cream-truck-in-philly-jimgolden.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T22:37:43.630Z", "filters": [] }, "11059": { "id": 11059, "searchable": true, "keywords": [ "still life", "sets", "tiny", "colorful", "mini", "scale model", "cars", "trucks", "miniature" ], "size": { "content": { "width": 1645, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 238822 }, "label": "volkswagen-van-camping-summer-jimgolden", "type": "image", "content": "volkswagen-van-camping-summer-jimgolden.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T22:37:45.646Z", "filters": [], "key": "11059" }, "11060": { "id": 11060, "size": { "content": { "width": 1860, "height": 988 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 281546 }, "keywords": [], "label": "citroen-DS-automotive-cars-jimgolden", "type": "image", "content": "citroen-DS-automotive-cars-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2020-10-30T22:37:49.008Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11061": { "id": 11061, "searchable": true, "keywords": [ "still life", "sets", "tiny", "colorful", "mini", "scale model", "cars", "trucks", "miniature" ], "size": { "content": { "width": 1836, "height": 988 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 344535 }, "label": "citroen-DS-automotive-cars-jimgolden-pdx", "type": "image", "content": "citroen-DS-automotive-cars-jimgolden-pdx.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T22:38:49.646Z", "filters": [] }, "11062": { "id": 11062, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "[linkedin]", "type": "link", "content": "https://www.linkedin.com/in/jimgoldenstudio/", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T23:44:22.313Z", "filters": [ "Footer Links" ], "key": "11062" }, "11063": { "id": 11063, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "[instagram]", "type": "link", "content": "http://instagram.com/jim.golden.studio#", "thumb": "", "linkTarget": "_blank", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2020-10-30T23:49:59.583Z", "filters": [ "Footer Links" ], "key": "11063" }, "11064": { "id": 11064, "keywords": [], "size": { "content": { "width": 1426, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 273270 }, "label": "sewing-machine-collection", "type": "image", "content": "sewing-machine-collection.jpg", "thumb": "", "linkTarget": "", "caption": "collection of sewing notions in shape of a sewing machine on pink background", "overrides": {}, "featuredImage": "", "dateAdded": "2020-11-11T18:31:17.064Z", "filters": [], "key": "11064" }, "11065": { "id": 11065, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor", "earthtones" ], "size": { "content": { "width": 885, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 253081 }, "label": "unique shaped earth tone tiles on a tile background", "type": "image", "content": "COPROJ-ANN-SACKS-MQ4-211-CROP.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-01-07T21:58:05.058Z", "filters": [], "key": "11065", "searchable": true }, "11066": { "id": 11066, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 573823 }, "keywords": [ "tile", "ann sack tile", "neutral", "natural", "color", "leaves", "moss", "wood", "interiors", "luxury" ], "label": "neutral by nature Ann Sacks Tile collection jim golden", "type": "image", "content": "MADE_1Q_2021_FINAL-5.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-02-18T18:48:20.627Z", "caption": "neutral by nature Ann Sacks Tile collection jim golden", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11067": { "id": 11067, "size": { "content": { "width": 871, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 230492 }, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor" ], "label": "Ann Sacks and Rejuvenation tile hardware collaboration", "type": "image", "content": "COPROJ-ANN-SACKS-MQ12021-097.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-02-18T18:48:22.987Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11067" }, "11068": { "id": 11068, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 264212 }, "keywords": [], "label": "HoneyMamas-SL-coconuts-0057", "type": "image", "content": "HoneyMamas-SL-coconuts-0057.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-02-18T19:42:14.876Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-04-18T19:56:22.466Z" }, "11069": { "id": 11069, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148067 }, "keywords": [], "label": "plastic-produce-bag-on-pink-background", "type": "image", "content": "plastic-produce-bag-on-pink-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T13:48:20.888Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11070": { "id": 11070, "size": { "content": { "width": 1026, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 149879 }, "keywords": [ "flowers", "flora", "bloom", "rhodedendron" ], "label": "rhodedendron-branch-back-on-black", "type": "image", "content": "rhodedendron-branch-back-on-black.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:00:15.766Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11071": { "id": 11071, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 139290 }, "keywords": [ "flowers", "flora", "bloom", "rhodedendron" ], "label": "rhodedendron-blossom-glowing", "type": "image", "content": "rhodedendron-blossom-glowing.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:00:19.356Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11072": { "id": 11072, "size": { "content": { "width": 956, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 132142 }, "keywords": [ "flowers", "flora", "bloom", "rhodedendron" ], "label": "rhodedendron-branch-on-black-background", "type": "image", "content": "rhodedendron-branch-on-black-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:00:23.431Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11073": { "id": 11073, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261105 }, "keywords": [ "flowers", "flora", "bloom", "dried", "sunflower" ], "label": "dried-sunflower-on-blue-background", "type": "image", "content": "dried-sunflower-on-blue-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:00:35.957Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11074": { "id": 11074, "size": { "content": { "width": 759, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 135211 }, "keywords": [ "flowers", "flora", "bloom", "dried", "sunflower" ], "label": "back-of-dried-sunflower", "type": "image", "content": "back-of-dried-sunflower.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:00:39.948Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11075": { "id": 11075, "searchable": true, "keywords": [ "flowers", "flora", "bloom", "plant", "ranunculus" ], "size": { "content": { "width": 1326, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 222914 }, "label": "dried-protea-side-view", "type": "image", "content": "dried-protea-side-view.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T14:04:18.346Z", "filters": [] }, "11076": { "id": 11076, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181720 }, "keywords": [ "flowers", "flora", "bloom", "plant", "ranunculus" ], "label": "protea-blossom-on-mottled-background-jimgolden", "type": "image", "content": "protea-blossom-on-mottled-background-jimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:21.342Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11077": { "id": 11077, "size": { "content": { "width": 1036, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 176221 }, "keywords": [ "flowers", "flora", "bloom", "plant", "ranunculus" ], "label": "protea-blossom-on-mottled-background", "type": "image", "content": "protea-blossom-on-mottled-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:25.206Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11078": { "id": 11078, "size": { "content": { "width": 1097, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 88452 }, "keywords": [], "label": "rear-view-yellow-lily-flora-photography", "type": "image", "content": "rear-view-yellow-lily-flora-photography.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:27.686Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11079": { "id": 11079, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 56184 }, "keywords": [], "label": "drooping-yellow-lily-flower", "type": "image", "content": "drooping-yellow-lily-flower.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:29.658Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11080": { "id": 11080, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 76906 }, "keywords": [ "flowers", "flora", "bloom", "plant", "lily" ], "label": "inside-lily-blossom-yellow", "type": "image", "content": "inside-lily-blossom-yellow.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:31.532Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11081": { "id": 11081, "size": { "content": { "width": 1373, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 121286 }, "keywords": [ "flowers", "flora", "bloom", "plant", "lily" ], "label": "rear-view-red-lily", "type": "image", "content": "rear-view-red-lily.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:33.989Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11082": { "id": 11082, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 110888 }, "keywords": [ "flowers", "flora", "bloom", "plant", "lily" ], "label": "red-lily-drooping-black-background", "type": "image", "content": "red-lily-drooping-black-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:39.078Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11083": { "id": 11083, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 233304 }, "keywords": [ "flowers", "flora", "bloom", "plant", "artichoke" ], "label": "artichoke-plant-on-black", "type": "image", "content": "artichoke-plant-on-black.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:44.289Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11084": { "id": 11084, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 161796 }, "keywords": [ "flowers", "flora", "bloom", "plant", "artichoke" ], "label": "macro-artichoke-blossom", "type": "image", "content": "macro-artichoke-blossom.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:46.918Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11085": { "id": 11085, "size": { "content": { "width": 1161, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 164256 }, "keywords": [ "flowers", "flora", "bloom", "plant", "artichoke" ], "label": "artichoke-blossom-with-purple-flower", "type": "image", "content": "artichoke-blossom-with-purple-flower.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:04:50.732Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11086": { "id": 11086, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 153473 }, "keywords": [ "flowers", "flora", "bloom", "leaf", "fall", "autumn" ], "label": "thin-yellow-leaf-fall", "type": "image", "content": "thin-yellow-leaf-fall.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:06:45.484Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11087": { "id": 11087, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196113 }, "keywords": [ "flowers", "flora", "bloom", "leaf", "fall", "autumn", "yellow", "gold" ], "label": "crumpled-yellow-fall-leaf", "type": "image", "content": "crumpled-yellow-fall-leaf.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:06:48.666Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11088": { "id": 11088, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 124811 }, "keywords": [ "flowers", "flora", "bloom", "leaf", "fall", "autumn", "red" ], "label": "red-yellow-green-maple-leaf-turning-fall", "type": "image", "content": "red-yellow-green-maple-leaf-turning-fall.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:06:51.906Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11089": { "id": 11089, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 120655 }, "keywords": [ "flowers", "flora", "bloom", "leaf", "fall", "autumn", "red" ], "label": "twisted-red-leaf", "type": "image", "content": "twisted-red-leaf.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T14:06:56.068Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11090": { "id": 11090, "size": { "content": { "width": 1146, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 231359 }, "keywords": [], "label": "amazon-dot-com-avis-car-rental-summer-raod-trip", "type": "image", "content": "amazon-dot-com-avis-car-rental-summer-raod-trip.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:30:36.726Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11091": { "id": 11091, "size": { "content": { "width": 3002, "height": 1840 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 838859 }, "keywords": [], "label": "amazon-avis-summer-road-trip-gear", "type": "image", "content": "amazon-avis-summer-road-trip-gear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:30:38.126Z", "caption": "", "featuredImage": "", "overrides": { "thumbScaleFactor": true }, "filters": [], "key": "11091", "searchable": true }, "11092": { "id": 11092, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 251837 }, "keywords": [ "hoka", "running", "shoe", "footwear", "sneaker", "trainer", "dragster", "burnout" ], "label": "hoka one one mach3 sneaker dragster burnout", "type": "image", "content": "hoka-mach3-dragster-burnout-sneaker.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:43:50.331Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11093": { "id": 11093, "searchable": true, "keywords": [ "hoka", "running", "shoe", "footwear", "sneaker", "trainer", "trail runner", "off road" ], "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 608722 }, "label": "hoka one one trail running shoe speedgoat", "type": "image", "content": "hoka-one-one-trail-running-shoe-speedgoat.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:44:23.865Z", "filters": [] }, "11094": { "id": 11094, "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 205009 }, "keywords": [ "hoka", "running", "shoe", "footwear", "sneaker", "trainer" ], "label": "hoka one one light as a feather cave sneaker", "type": "image", "content": "hoka-one-one-light-as-a-feather-cavu-footwear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:44:57.051Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11095": { "id": 11095, "searchable": true, "keywords": [ "hoka", "running", "shoe", "footwear", "sneaker", "trainer" ], "size": { "content": { "width": 1584, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 729048 }, "label": "hoka one one running shoe on infinite loop arahi", "type": "image", "content": "hoka-arahi-infinite-loop-running-shoe.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:45:29.634Z", "filters": [] }, "11096": { "id": 11096, "size": { "content": { "width": 1860, "height": 1046 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 280053 }, "keywords": [], "label": "hoka one one running shoe as a spaceship carbonx", "type": "image", "content": "hoka-one-one-running-shoe-spaceship-carbonx.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:47:08.909Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11097": { "id": 11097, "size": { "content": { "width": 1860, "height": 1046 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 204468 }, "keywords": [ "shoe", "trainer", "sneaker", "footwear", "rocket" ], "label": "hoka running shoe as rocket", "type": "image", "content": "hoka-running-shoe-as-rocket.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:47:12.294Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11097", "searchable": true }, "11098": { "id": 11098, "searchable": true, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "size": { "content": { "width": 1519, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 122309 }, "label": "nike tokyo olympics athlete zoomX trainer", "type": "image", "content": "nike-toyko-olmpics-ZOOMX-trainer.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:55:22.332Z", "filters": [] }, "11099": { "id": 11099, "searchable": true, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 118845 }, "label": "nike tokyo olympics athlete zoomX trainer", "type": "image", "content": "nike-toyko-olmpics-ZOOMX-track-shoe.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:55:23.559Z", "filters": [] }, "11100": { "id": 11100, "searchable": true, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "size": { "content": { "width": 1521, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148110 }, "label": "nike tokyo olympics athlete glide flyease shoe", "type": "image", "content": "nike-toyko-olmpics-GLIDE-FLYEASE-sneaker.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:55:24.993Z", "filters": [] }, "11101": { "id": 11101, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 158955 }, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "label": "nike-toyko-olmpics-GLIDE-FLYEASE-shoe", "type": "image", "content": "nike-toyko-olmpics-GLIDE-FLYEASE-shoe.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T18:55:26.231Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11102": { "id": 11102, "searchable": true, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 77597 }, "label": "nike tokyo olympics athlete apparel 2020", "type": "image", "content": "nike-athletic-apparel-tokyo-olympics-2020.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:55:41.311Z", "filters": [] }, "11103": { "id": 11103, "searchable": true, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 64714 }, "label": "nike tokyo olympics athlete apparel", "type": "image", "content": "nike-tokyo-olympics-athlete-apparel.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:55:42.457Z", "filters": [], "key": "11103" }, "11104": { "id": 11104, "searchable": true, "keywords": [ "nike", "olympics", "sportswear", "footwear", "athletics", "trainer", "shoe", "sneaker" ], "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 67465 }, "label": "nike tokyo olympics athlete apparel", "type": "image", "content": "nike-apparel-white-on-white-2020-olympics.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T18:55:43.731Z", "filters": [] }, "11105": { "id": 11105, "searchable": true, "keywords": [ "hoka", "running", "shoe", "footwear", "sneaker", "trainer", "balloons", "daily" ], "size": { "content": { "width": 1618, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 379713 }, "label": "hoka one one shoe stepping on balloons that are the names of the days of the week", "type": "image", "content": "hoka-one-one-running-shoe-weeday-balloons.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T19:04:57.289Z", "filters": [] }, "11106": { "id": 11106, "searchable": true, "keywords": [ "hoka", "running", "shoe", "footwear", "sneaker", "trainer", "roadrunner", "desert" ], "size": { "content": { "width": 1618, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 429100 }, "label": "hoka one one sneaker as the roadrunner in the desert", "type": "image", "content": "hoka-trail-runner-desert-torrent.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-09-09T19:05:36.718Z", "filters": [] }, "11107": { "id": 11107, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 339037 }, "keywords": [], "label": "hoka-arahi4-shockwave", "type": "image", "content": "hoka-arahi4-shockwave.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T19:56:48.149Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11108": { "id": 11108, "size": { "content": { "width": 1232, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 272907 }, "keywords": [], "label": "hoka-one-one-clifton-edge-wings", "type": "image", "content": "hoka-one-one-clifton-edge-wings.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T19:56:53.006Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2021-09-09T21:07:35.312Z", "key": "11108" }, "11109": { "id": 11109, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 353671 }, "keywords": [], "label": "hoka-arahi4-shockwave-2", "type": "image", "content": "hoka-arahi4-shockwave-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:01:26.756Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2021-09-09T21:07:35.312Z" }, "11110": { "id": 11110, "size": { "content": { "width": 995, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 128692 }, "keywords": [], "label": "folded-paper-pattern-papercraft", "type": "image", "content": "folded-paper-pattern-papercraft.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:11.275Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11111": { "id": 11111, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 102769 }, "keywords": [], "label": "folded-paper-art-on-white-background", "type": "image", "content": "folded-paper-art-on-white-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:12.625Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11112": { "id": 11112, "size": { "content": { "width": 926, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 44368 }, "keywords": [], "label": "crashing-blue-paper-spacecraft", "type": "image", "content": "crashing-blue-paper-spacecraft.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:13.966Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11113": { "id": 11113, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 52972 }, "keywords": [], "label": "folded-blue-paper-UFO", "type": "image", "content": "folded-blue-paper-UFO.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:15.245Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11113" }, "11114": { "id": 11114, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 46909 }, "keywords": [], "label": "blue-folded-paper-spaceship", "type": "image", "content": "blue-folded-paper-spaceship.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:16.878Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11115": { "id": 11115, "size": { "content": { "width": 1024, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106175 }, "keywords": [], "label": "radial-folded-paper-art", "type": "image", "content": "radial-folded-paper-art.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:17.924Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11116": { "id": 11116, "size": { "content": { "width": 922, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108955 }, "keywords": [], "label": "paper-art-radial-pattern-folded", "type": "image", "content": "paper-art-radial-pattern-folded.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-09T20:12:19.732Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11117": { "id": 11117, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Jim Golden Studio Reel", "type": "video", "content": "vimeo:575558944", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-14T21:32:21.196Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2021-09-14T21:33:00.341Z", "key": "11117" }, "11118": { "id": 11118, "size": { "content": { "width": 2026, "height": 1148 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 984194 }, "keywords": [], "label": "ScreenShot2021-09-14at2.39.44PM", "type": "image", "content": "ScreenShot2021-09-14at2.39.44PM.png", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-14T21:40:04.074Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11119": { "id": 11119, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 460898 }, "keywords": [], "label": "bev-tray", "type": "image", "content": "bev-tray.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-09-14T22:43:07.065Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11120": { "id": 11120, "searchable": true, "keywords": [ "gourds", "suitcase", "hotelroom", "island", "tropical", "vacation", "fun", "party", "weed", "hat", "palmtree" ], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 532272 }, "label": "collection of gourds in a suitcase on vacation on a tropical island", "type": "image", "content": "GOURDS-VACAY-376-copy.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-10-21T17:46:29.596Z", "filters": [], "key": "11120" }, "11121": { "id": 11121, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 129009 }, "keywords": [], "label": "white gourd on navy blue background", "type": "image", "content": "GOURDS-SINGLES-2458.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:31.039Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11121", "searchable": true }, "11122": { "id": 11122, "size": { "content": { "width": 982, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 137309 }, "keywords": [ "gourd", "orange", "produce", "vegetable" ], "label": "orange gourd on navy background", "type": "image", "content": "GOURDS-SINGLES-2449.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:32.653Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11122", "searchable": true }, "11123": { "id": 11123, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 113708 }, "keywords": [], "label": "GOURDS-SINGLES-2442", "type": "image", "content": "GOURDS-SINGLES-2442.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:34.126Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11124": { "id": 11124, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 211724 }, "keywords": [], "label": "GOURDS-SINGLES-2414", "type": "image", "content": "GOURDS-SINGLES-2414.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:35.548Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11125": { "id": 11125, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 325489 }, "keywords": [], "label": "GOURDS-SINGLES-2397", "type": "image", "content": "GOURDS-SINGLES-2397.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:37.294Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11126": { "id": 11126, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 99456 }, "keywords": [ "gourd", "orange", "black", "navy", "long neck", "vegetable" ], "label": "orange and black gourd with long neck on navy background ", "type": "image", "content": "GOURDS-SINGLES-2369.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:38.733Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11126", "searchable": true }, "11127": { "id": 11127, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 123376 }, "keywords": [ "gourd", "navy", "orange", "dramatic" ], "label": "orange and green gourd on navy blue background", "type": "image", "content": "GOURDS-SINGLES-2355.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:39.984Z", "caption": "orange and green gourd on navy blue background", "featuredImage": "", "overrides": {}, "filters": [], "key": "11127", "searchable": true }, "11128": { "id": 11128, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 105751 }, "keywords": [ "gourd", "white", "navy", "photo", "neck", "twisted" ], "label": "knobby white gourd on navy background", "type": "image", "content": "GOURDS-SINGLES-2350.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:41.714Z", "caption": "knobby white gourd on navy background", "featuredImage": "", "overrides": {}, "filters": [], "key": "11128", "searchable": true }, "11129": { "id": 11129, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 223362 }, "keywords": [], "label": "GOURDS-SINGLES-2338", "type": "image", "content": "GOURDS-SINGLES-2338.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:43.021Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11130": { "id": 11130, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 175307 }, "keywords": [], "label": "GOURDS-SINGLES-2281", "type": "image", "content": "GOURDS-SINGLES-2281.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:44.454Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11131": { "id": 11131, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 173316 }, "keywords": [], "label": "multicolored gourd on a navy blue background", "type": "image", "content": "GOURDS-SINGLES-2257.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:45.658Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11131", "searchable": true }, "11132": { "id": 11132, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 104377 }, "keywords": [], "label": "GOURDS-SINGLES-2208", "type": "image", "content": "GOURDS-SINGLES-2208.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:46.914Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11133": { "id": 11133, "size": { "content": { "width": 739, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 82099 }, "keywords": [], "label": "yellow gourd on navy blue background", "type": "image", "content": "GOURDS-SINGLES-2169.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T17:46:48.103Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11133", "searchable": true }, "11134": { "id": 11134, "searchable": true, "keywords": [ "yellow gourd on navy blue background", "yellow", "navy", "gourd", "photo", "sexy", "dramatic" ], "size": { "content": { "width": 860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 114852 }, "label": "dramatic photo of a yellow gourd on a navy blue background", "type": "image", "content": "GOURDS-SINGLES-2166.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2021-10-21T17:46:49.333Z", "filters": [] }, "11135": { "id": 11135, "searchable": true, "keywords": [ "crazy", "gourd", "lady", "reading", "couch", "home" ], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 393338 }, "label": "crazy gourd lady reading at home", "type": "image", "content": "GOURDS-LADY-ANI-1742.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-10-21T17:46:50.835Z", "filters": [], "key": "11135" }, "11136": { "id": 11136, "searchable": true, "keywords": [], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 222370 }, "label": "case-ani-4-copy", "type": "image", "content": "case-ani-4-copy.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-10-21T17:46:52.117Z", "filters": [], "key": "11136" }, "11137": { "id": 11137, "searchable": true, "keywords": [ "gourds", "collection", "layflat", "things organized neatly", "topdown", "knolling", "fall", "halloween", "harvest" ], "size": { "content": { "width": 1560, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 385375 }, "label": "collection of gourds photographed on a tan background", "type": "image", "content": "GOURD-COLLECTION-14054.jpg", "thumb": "", "linkTarget": "", "caption": "collection of colorful fall gourds on a tan background", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-10-21T17:54:50.841Z", "filters": [], "key": "11137" }, "11138": { "id": 11138, "size": { "content": { "width": 1537, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 387766 }, "keywords": [], "label": "LOCK-COLLECTION-59-1", "type": "image", "content": "LOCK-COLLECTION-59-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T20:06:03.234Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11139": { "id": 11139, "size": { "content": { "width": 1451, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 255805 }, "keywords": [], "label": "white on white collection of foam cups", "type": "image", "content": "FOAMIES-082-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T20:06:19.563Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11140": { "id": 11140, "size": { "content": { "width": 1537, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 387766 }, "keywords": [], "label": "PAD-LOCK-COLLECTIONjpg", "type": "image", "content": "PAD-LOCK-COLLECTIONjpg.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-10-21T20:11:15.309Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11141": { "id": 11141, "searchable": true, "keywords": [ "zany gourd lady like wes anderson", "crazy", "lady", "zany", "eccentric", "gourd", "couch", "room", "reading", "GIF", "animation", "motion" ], "size": { "content": { "width": 1000, "height": 747 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 7423926 }, "label": "zany gourd lady like wes anderson", "type": "image", "content": "GOURD-LADY-ANI.FLAT.SM.gif", "thumb": "", "linkTarget": "", "caption": "older women sitting on a green couch surrounded by gourds reading a book", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-10-22T18:45:31.107Z", "filters": [], "key": "11141" }, "11142": { "id": 11142, "searchable": true, "keywords": [], "size": { "content": { "width": 1000, "height": 703 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 5824875 }, "label": "case-ani-4.FLAT.SM", "type": "image", "content": "case-ani-4.FLAT.SM.gif", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-10-23T20:37:55.036Z", "filters": [] }, "11143": { "id": 11143, "searchable": true, "keywords": [ "gourds", "briefcase", "security", "handcuff", "moody", "dark", "drug deal" ], "size": { "content": { "width": 1000, "height": 667 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4660524 }, "label": "stolen gourds in metal briefcase", "type": "image", "content": "xcase-ani-4.FLAT.SM.gif", "thumb": "", "linkTarget": "", "caption": "moody image of stolen gourds in metal briefcase", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-11-08T21:50:10.313Z", "filters": [], "key": "11143" }, "11144": { "id": 11144, "searchable": true, "keywords": [ "amazon", "avis", "road trip", "outdoor gear", "travel", "winter", "rooftop", "equipment" ], "size": { "content": { "width": 1860, "height": 1139 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 312734 }, "label": "amazon winter hero road trip roof rack", "type": "image", "content": "amazon-winter-hero.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2021-11-22T17:56:31.639Z", "filters": [], "key": "11144" }, "11145": { "id": 11145, "size": { "content": { "width": 1319, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 370434 }, "keywords": [ "behind the scenes", "amazon", "avis", "pull back the curtain" ], "label": "behind the scenes of a car in a photo studio", "type": "image", "content": "IMG_7827.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2021-11-22T18:00:59.856Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11146": { "id": 11146, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 577976 }, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor", "blue" ], "label": "Ann Sacks Tile captivating blues tile collection", "type": "image", "content": "MADE_4Q_2021_FINAL_spreads-8.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-01-11T00:35:03.636Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11147": { "id": 11147, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 575429 }, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor", "green" ], "label": "Ann Sacks tile verdant greens tile collection", "type": "image", "content": "MADE_4Q_2021_FINAL_spreads-6.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-01-11T00:35:05.873Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11148": { "id": 11148, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 391469 }, "keywords": [ "tile", "interiors", "Ann Sacks", "rich", "neutral", "pastels", "light", "fancy", "collage" ], "label": "Ann Sacks tile Statement Neutrals tile collage", "type": "image", "content": "MADE_4Q_2021_FINAL_spreads-3.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-01-11T00:35:10.415Z", "caption": "Ann Sacks tile Statement Neutrals tile collage\n", "featuredImage": "", "overrides": {}, "filters": [], "key": "11148", "searchable": true }, "11149": { "id": 11149, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 430261 }, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor", "green", "blue", "white" ], "label": "ann sacks tile color theory tile collection", "type": "image", "content": "MADE_4Q_2021_FINAL_spreads-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-01-11T00:35:12.459Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11150": { "id": 11150, "size": { "content": { "width": 1762, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 651832 }, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor", "dark", "black", "gray" ], "label": "ann sacks tile chiaroscuro tile collection", "type": "image", "content": "MADE_4Q_2021_FINAL_spreads-11.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-01-11T00:35:16.211Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11151": { "id": 11151, "size": { "content": { "width": 881, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 220511 }, "keywords": [ "tiles", "luxury", "ann sacks", "interior", "decor", "cover", "editorial", "magalog" ], "label": "ann sacks tile color theory magazine cover", "type": "image", "content": "MADE_4Q_2021_FINAL_spreads-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-01-11T00:35:17.581Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11152": { "id": 11152, "searchable": true, "keywords": [ "lemon", "kushcannabis", "pot", "flower", "weed", "marijuana", "plant", "colorful", "red", "green", "yellow" ], "size": { "content": { "width": 924, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 154887 }, "label": "cannabis sativa flowering plant", "type": "image", "content": "WHEED-195.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-01-18T21:04:28.269Z", "filters": [], "key": "11152" }, "11153": { "id": 11153, "searchable": true, "keywords": [ "lemon", "kushcannabis", "pot", "flower", "weed", "marijuana", "plant" ], "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150657 }, "label": "cannabis sativa single leaf Jim Golden", "type": "image", "content": "WHEED-058.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-01-18T21:04:29.218Z", "filters": [] }, "11154": { "id": 11154, "searchable": true, "keywords": [ "cannabis plant pot weed marijuana flower", "rainbow", "colors", "on black", "flower", "plant", "ganja", "sensi", "maryjane" ], "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 243516 }, "label": "flowering marijuana plant red leaves", "type": "image", "content": "WHEED-005.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": { "thumbScaleFactor": true }, "featuredImage": "", "dateAdded": "2022-01-18T21:04:30.497Z", "filters": [], "key": "11154" }, "11155": { "id": 11155, "size": { "content": { "width": 641, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 62505 }, "keywords": [ "gshock", "watch", "timepice", "murdered out", "black on black", "tough", "mens", "dark", "unique" ], "label": "dark photo of a black GSHOCK GA2100-1A1 WATCH on black background", "type": "image", "content": "GSHOCK-GA2100-1A1-WATCH.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:50.132Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11156": { "id": 11156, "size": { "content": { "width": 641, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 59809 }, "keywords": [ "gshock", "watch", "timepiece", "bright", "white", "white on white", "tough", "mens" ], "label": "bright white GSHOCK GA2100-7A-WATCHon white background", "type": "image", "content": "GSHOCK-GA2100-7A-WATCHjpg.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:52.130Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11157": { "id": 11157, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198568 }, "keywords": [], "label": "gshock-transparent-watches", "type": "image", "content": "gshock-transparent-watches.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:53.847Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11158": { "id": 11158, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 145995 }, "keywords": [], "label": "GSHOCK-watch-GA700SKE-185", "type": "image", "content": "GSHOCK-watch-GA700SKE-185.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:55.289Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11159": { "id": 11159, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144106 }, "keywords": [ "gshock", "watch", "tough", "waterproof", "timepiece", "shock resistant", "transparent" ], "label": "GSHOCK transparent watch GA2100SKEon a summery gradient background", "type": "image", "content": "GSHOCK-watch-GA2100SKE-203.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:57.051Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11160": { "id": 11160, "size": { "content": { "width": 641, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 61902 }, "keywords": [ "gshock", "watch", "tough", "waterproof", "timepiece", "shock resistant", "women", "still life" ], "label": "GSHOCK WOMENS GMAS2100 watch on a pink orange gradient background", "type": "image", "content": "GSHOCK-WOMENS-GMAS2100-ALT.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:58.255Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11160", "searchable": true }, "11161": { "id": 11161, "size": { "content": { "width": 641, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 65064 }, "keywords": [ "gshock", "watch", "tough", "waterproof", "timepiece", "shock resistant", "womens" ], "label": "GSHOCK WOMENS GMAS2100 watch on a green black on a green background", "type": "image", "content": "GSHOCK-WOMENS-GMAS2100.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-18T22:31:59.369Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11161" }, "11162": { "id": 11162, "size": { "content": { "width": 641, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1184673 }, "keywords": [ "gshock", "timepiece", "watch", "animation", "balck and white", "dramatic", "moving" ], "label": "gshock GA2100 black and white watch animation", "type": "image", "content": "GSHOCK-BW-ANI.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T20:30:49.205Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11163": { "id": 11163, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 160242 }, "keywords": [ "gshock", "timepiece", "watch", "tough", "mens", "waterproof", "shockproof", "black and white" ], "label": "gshock GA2100 watches split with water white and black background", "type": "image", "content": "SPLIT-1-copy.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T20:43:21.206Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11164": { "id": 11164, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 209878 }, "keywords": [], "label": "REEBOK-SS19-STORIES-MAY_0205_V2_RGB", "type": "image", "content": "REEBOK-SS19-STORIES-MAY_0205_V2_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:06.075Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11165": { "id": 11165, "size": { "content": { "width": 1751, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 183811 }, "keywords": [], "label": "REEBOK-SS19-STORIES-MAY_0098_V2_RGB", "type": "image", "content": "REEBOK-SS19-STORIES-MAY_0098_V2_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:07.617Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11166": { "id": 11166, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 257631 }, "keywords": [], "label": "REEBOK-SS19-STORIES-FEB_0470_V1_RGB", "type": "image", "content": "REEBOK-SS19-STORIES-FEB_0470_V1_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:15.815Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11167": { "id": 11167, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 333930 }, "keywords": [], "label": "REEBOK-FW19-OCT_0114_V2_RGB", "type": "image", "content": "REEBOK-FW19-OCT_0114_V2_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:17.628Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11168": { "id": 11168, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 247010 }, "keywords": [], "label": "REEBOK-FW19-OCT_0092_V2_RGB", "type": "image", "content": "REEBOK-FW19-OCT_0092_V2_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:18.862Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11169": { "id": 11169, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 286667 }, "keywords": [], "label": "REEBOK-FW19-NOV-W_0715_V1_RGB", "type": "image", "content": "REEBOK-FW19-NOV-W_0715_V1_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:20.126Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11170": { "id": 11170, "size": { "content": { "width": 1666, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 278223 }, "keywords": [], "label": "REEBOK-FW19-NOV-W_0677_V1_RGB", "type": "image", "content": "REEBOK-FW19-NOV-W_0677_V1_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:22.040Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11170" }, "11171": { "id": 11171, "size": { "content": { "width": 1860, "height": 986 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 290409 }, "keywords": [], "label": "REEBOK-FW19-NOV-M_0801_V1_RGB", "type": "image", "content": "REEBOK-FW19-NOV-M_0801_V1_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:23.333Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11172": { "id": 11172, "size": { "content": { "width": 1634, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 265319 }, "keywords": [], "label": "REEBOK-FW19-JULY-W_0396-ALT_V2", "type": "image", "content": "REEBOK-FW19-JULY-W_0396-ALT_V2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:24.375Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11172", "searchable": true }, "11173": { "id": 11173, "size": { "content": { "width": 1563, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261962 }, "keywords": [], "label": "REEBOK-FW19-DEC-M_0941_V1_RGB", "type": "image", "content": "REEBOK-FW19-DEC-M_0941_V1_RGB.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:25.384Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11174": { "id": 11174, "size": { "content": { "width": 1331, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 303543 }, "keywords": [], "label": "Reebok cross trainer stories", "type": "image", "content": "REEBOK-FW19-AUG-W_0238.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:27.650Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11175": { "id": 11175, "size": { "content": { "width": 1465, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 244194 }, "keywords": [], "label": "reebok cross trainer color story", "type": "image", "content": "REEBOK-FW19-AUG-W_0225.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-19T21:56:29.750Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11175", "searchable": true }, "11176": { "id": 11176, "searchable": true, "keywords": [], "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 202145 }, "label": "sherwin williams paint softer side pastels", "type": "image", "content": "sherwinwillaimsoaintsoftersidepastels.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-04-25T17:45:34.979Z", "filters": [], "key": "11176" }, "11177": { "id": 11177, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 213824 }, "keywords": [], "label": "sherwin williams paint traditional tone naturals", "type": "image", "content": "sherwinwilliamspainttraditionaltonenaturals.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-25T17:45:36.096Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2023-02-21T20:09:01.763Z", "searchable": true }, "11178": { "id": 11178, "size": { "content": { "width": 945, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196025 }, "keywords": [], "label": "Seth ciferri tattoo machine collection", "type": "image", "content": "sethciferritattoomachinecollection.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-04-25T17:47:17.255Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11179": { "id": 11179, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 183494 }, "keywords": [], "label": "after sunset Oregon coast", "type": "image", "content": "book-Page-100.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:24.251Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11180": { "id": 11180, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 194583 }, "keywords": [], "label": "man with binoculars Oregon coast", "type": "image", "content": "book-Page-98.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:25.347Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11181": { "id": 11181, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 301153 }, "keywords": [], "label": "sunset cape meares Oregon coast", "type": "image", "content": "book-Page-96.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:27.089Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11182": { "id": 11182, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 326328 }, "keywords": [], "label": "beach patterns sunset going coastal Jim golden", "type": "image", "content": "book-Page-94.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:28.679Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11183": { "id": 11183, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 271152 }, "keywords": [], "label": "surf casting fisherman Oregon coast", "type": "image", "content": "book-Page-92.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:30.020Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11184": { "id": 11184, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 284849 }, "keywords": [], "label": "yaquina head lighthouse going coastal Jim golden", "type": "image", "content": "book-Page-90.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:31.589Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11185": { "id": 11185, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 456456 }, "keywords": [], "label": "odd shaped house Oregon ", "type": "image", "content": "book-Page-88.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:32.934Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11186": { "id": 11186, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 248338 }, "keywords": [], "label": "rv parked port orford Oregon ", "type": "image", "content": "book-Page-86.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:34.320Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11187": { "id": 11187, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 362349 }, "keywords": [], "label": "old man sea painting ", "type": "image", "content": "book-Page-84.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:35.842Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11188": { "id": 11188, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 319167 }, "keywords": [], "label": "buoy in sea foam sandy beach", "type": "image", "content": "book-Page-82.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:38.092Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11189": { "id": 11189, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 262169 }, "keywords": [], "label": "lighthouse in driftwood bandon", "type": "image", "content": "book-Page-80.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:39.388Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11190": { "id": 11190, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328326 }, "keywords": [], "label": "arched cove going coastal Jim golden", "type": "image", "content": "book-Page-78.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:40.920Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11191": { "id": 11191, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 239354 }, "keywords": [], "label": "book-Page-76", "type": "image", "content": "book-Page-76.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:42.250Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11192": { "id": 11192, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 433200 }, "keywords": [], "label": "path to beach going coastal Jim golden", "type": "image", "content": "book-Page-74.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:46.784Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11193": { "id": 11193, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 388692 }, "keywords": [], "label": "rock arches Oregon coast", "type": "image", "content": "book-Page-72.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:48.098Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11194": { "id": 11194, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 254231 }, "keywords": [], "label": "waves splashing tree stump", "type": "image", "content": "book-Page-70.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:49.248Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11195": { "id": 11195, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 301370 }, "keywords": [], "label": "gulls flying above dune cloudy day", "type": "image", "content": "book-Page-68.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:50.724Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11196": { "id": 11196, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 454821 }, "keywords": [], "label": "vintage jeep parked at beach", "type": "image", "content": "book-Page-66.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:56.447Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11197": { "id": 11197, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 551309 }, "keywords": [], "label": "houses going coastal Jim golden", "type": "image", "content": "book-Page-64.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:58.371Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11198": { "id": 11198, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 436209 }, "keywords": [], "label": "Aframe house sand ripples", "type": "image", "content": "book-Page-62.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:12:59.817Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11199": { "id": 11199, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 411679 }, "keywords": [], "label": "house on the dune Rockaway beach", "type": "image", "content": "book-Page-60.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:01.074Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11200": { "id": 11200, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 533453 }, "keywords": [], "label": "aframe house manzanita Oregon ", "type": "image", "content": "book-Page-58.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:04.826Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11201": { "id": 11201, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 404184 }, "keywords": [], "label": "house in dune grass manzanita", "type": "image", "content": "book-Page-56.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:06.306Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11202": { "id": 11202, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 485689 }, "keywords": [], "label": "colors patterns going coastal Jim golden", "type": "image", "content": "book-Page-54.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:07.778Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11203": { "id": 11203, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 314493 }, "keywords": [], "label": "fishing boat on land", "type": "image", "content": "book-Page-52.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:09.349Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11204": { "id": 11204, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 362300 }, "keywords": [], "label": "family on beach weird cloud", "type": "image", "content": "book-Page-50.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:10.754Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11205": { "id": 11205, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 330304 }, "keywords": [], "label": "sunrise misty trees going coastal Jim golden", "type": "image", "content": "book-Page-48.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:11.875Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11206": { "id": 11206, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 660441 }, "keywords": [], "label": "ripples in sand at low tide", "type": "image", "content": "book-Page-46.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:29.943Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11207": { "id": 11207, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 169012 }, "keywords": [], "label": "sunset Oregon coast going coastal Jim golden", "type": "image", "content": "book-Page-44.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:32.193Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11208": { "id": 11208, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 270706 }, "keywords": [], "label": "house at sunset orange windows", "type": "image", "content": "book-Page-42.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:33.297Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11209": { "id": 11209, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 386904 }, "keywords": [], "label": "lighthouse dusk crescent city", "type": "image", "content": "book-Page-40.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:34.746Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11210": { "id": 11210, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 518704 }, "keywords": [], "label": "sunset with tree branch ", "type": "image", "content": "book-Page-38.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:36.857Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11211": { "id": 11211, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 374776 }, "keywords": [], "label": "Aframe house at sunset cape meares", "type": "image", "content": "book-Page-36.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:38.086Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11212": { "id": 11212, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 386137 }, "keywords": [], "label": "low tide rocky beach", "type": "image", "content": "book-Page-34.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:39.343Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11213": { "id": 11213, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 428262 }, "keywords": [], "label": "old beach cabin near tree", "type": "image", "content": "book-Page-32.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:40.818Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11214": { "id": 11214, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 272415 }, "keywords": [], "label": "cloudy day oceanside beach", "type": "image", "content": "book-Page-30.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:41.974Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11215": { "id": 11215, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 396079 }, "keywords": [], "label": "houses on rocky beach Oregon coast", "type": "image", "content": "book-Page-28.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:43.235Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11216": { "id": 11216, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 386084 }, "keywords": [], "label": "pink beachfront house roackaway beach", "type": "image", "content": "book-Page-26.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:44.406Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11217": { "id": 11217, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 379989 }, "keywords": [], "label": "businesses at Oregon coast", "type": "image", "content": "book-Page-24.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:45.614Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11218": { "id": 11218, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 290082 }, "keywords": [], "label": "boat on land Astoria Oregon ", "type": "image", "content": "book-Page-22.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:46.767Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11219": { "id": 11219, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 383855 }, "keywords": [], "label": "driftwood beach Oregon coast", "type": "image", "content": "book-Page-20.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:48.954Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11220": { "id": 11220, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 586131 }, "keywords": [], "label": "Aframe house Oregon coast going coastal Jim golden", "type": "image", "content": "book-Page-18.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:51.086Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11221": { "id": 11221, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 377546 }, "keywords": [], "label": "houses in Rockaway beach Oregon going coastal Jim golden", "type": "image", "content": "book-Page-16.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:53.430Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11222": { "id": 11222, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 443628 }, "keywords": [], "label": "water splashing shore acres state park", "type": "image", "content": "book-Page-14.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:54.881Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11223": { "id": 11223, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 398713 }, "keywords": [], "label": "driftwood pond arch cape going coastal Jim golden", "type": "image", "content": "book-Page-12.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:56.355Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11224": { "id": 11224, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 435573 }, "keywords": [], "label": "various lodgings going coastal Jim golden", "type": "image", "content": "book-Page-10.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:57.614Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11225": { "id": 11225, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 293634 }, "keywords": [], "label": "yaquina bay bridge going coastal Jim golden", "type": "image", "content": "book-Page-8.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:13:58.982Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11226": { "id": 11226, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 340050 }, "keywords": [], "label": "details of boats going coastal Jim golden", "type": "image", "content": "book-Page-6.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:14:00.139Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11227": { "id": 11227, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 507318 }, "keywords": [], "label": "coast house manzanita going coastal Jim golden", "type": "image", "content": "book-Page-4.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:14:02.457Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11228": { "id": 11228, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 525317 }, "keywords": [], "label": "dune and forest on the Oregon coast going coastal Jim golden", "type": "image", "content": "book-Page-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:14:04.202Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11229": { "id": 11229, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 273821 }, "keywords": [], "label": "manzanita house ship shape going coastal Jim golden", "type": "image", "content": "book-Page-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T19:14:05.432Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11229", "searchable": true }, "11230": { "id": 11230, "size": { "content": { "width": 852, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 243259 }, "keywords": [], "label": "toms garage window", "type": "image", "content": "20201127-TOMS-GIULIAS--100.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:17.551Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11231": { "id": 11231, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 337253 }, "keywords": [], "label": "alfa Romeo giulia", "type": "image", "content": "20201127-TOMS-GIULIAS--89.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:18.948Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11232": { "id": 11232, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 401101 }, "keywords": [], "label": "alfa Romeo front grill on wood wall", "type": "image", "content": "20201127-TOMS-GIULIAS--70.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:20.416Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11233": { "id": 11233, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 316281 }, "keywords": [], "label": "alfa Romeo front grill", "type": "image", "content": "20201127-TOMS-GIULIAS--43.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:21.762Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11234": { "id": 11234, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 321301 }, "keywords": [], "label": "alfa Romeo spider", "type": "image", "content": "20181213-LUCIA-12-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:23.267Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11235": { "id": 11235, "size": { "content": { "width": 1802, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 504909 }, "keywords": [], "label": "vintage alfa Romeo sedan", "type": "image", "content": "20181007-COLUMN-RALLY-29.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:25.003Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11236": { "id": 11236, "size": { "content": { "width": 1669, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 435952 }, "keywords": [], "label": "BMW alpina alfa romeo sedan", "type": "image", "content": "20181007-COLUMN-RALLY-27.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:27.923Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11237": { "id": 11237, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 218376 }, "keywords": [], "label": "statue of the queen", "type": "image", "content": "20180908-ABFM-101.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:30.193Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11238": { "id": 11238, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 427956 }, "keywords": [], "label": "vintage MGB", "type": "image", "content": "20180908-ABFM-93.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:31.530Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11239": { "id": 11239, "size": { "content": { "width": 1700, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 321458 }, "keywords": [], "label": "interior vintage MG", "type": "image", "content": "20180908-ABFM-92.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:32.759Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11240": { "id": 11240, "size": { "content": { "width": 1571, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 333121 }, "keywords": [], "label": "vintage tea set in British car", "type": "image", "content": "20180908-ABFM-60.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:34.064Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11241": { "id": 11241, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 425713 }, "keywords": [], "label": "sleeping Dalmatian in race track pit area", "type": "image", "content": "20180729-PIR-427.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:35.300Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11242": { "id": 11242, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 416248 }, "keywords": [], "label": "Porsches racing at the rose cup races", "type": "image", "content": "20180729-PIR-319.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:36.558Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11243": { "id": 11243, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 516464 }, "keywords": [], "label": "blue vintage porsche 911", "type": "image", "content": "20180729-PIR-246.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:45.780Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11244": { "id": 11244, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 338002 }, "keywords": [], "label": "volvo race car at portland international raceway", "type": "image", "content": "20180729-PIR-156.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:49.383Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "key": "11244", "searchable": true }, "11245": { "id": 11245, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 267232 }, "keywords": [], "label": "20180729-PIR-144", "type": "image", "content": "20180729-PIR-144.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:50.572Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11246": { "id": 11246, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 256268 }, "keywords": [], "label": "bmw sedan race car front corner", "type": "image", "content": "20180729-PIR-126.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:51.686Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11247": { "id": 11247, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 232311 }, "keywords": [], "label": "simonize Datsun 240z race car under tent", "type": "image", "content": "20180729-PIR-119.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:53.375Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11248": { "id": 11248, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 223442 }, "keywords": [], "label": "turquoise car interior", "type": "image", "content": "20180617-MICROCARSHOW-17.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:54.401Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11249": { "id": 11249, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 322862 }, "keywords": [], "label": "orange BMW 1600", "type": "image", "content": "20180617-MICROCARSHOW-12.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:56.274Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11250": { "id": 11250, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 395178 }, "keywords": [], "label": "alfa romeo motor", "type": "image", "content": "20180528-VEHICLES-20.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:57.813Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11251": { "id": 11251, "size": { "content": { "width": 1627, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 474070 }, "keywords": [], "label": "vintage alfa Romeo sedan", "type": "image", "content": "20180507-RANDOM-42.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:28:59.153Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11252": { "id": 11252, "size": { "content": { "width": 1561, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 301421 }, "keywords": [], "label": "woman standing next to vintage car", "type": "image", "content": "20180421-OLD-SPIDER-TOUR-1324.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:00.352Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11252" }, "11253": { "id": 11253, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 496992 }, "keywords": [], "label": "goldendale stage Oregon trail rally on a cloudy day", "type": "image", "content": "20170422-OTR2017-3142-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:01.954Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11254": { "id": 11254, "size": { "content": { "width": 1615, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 526656 }, "keywords": [], "label": "Subaru WRX on golden dale stages of Oregon trail rally", "type": "image", "content": "20170422-OTR2017-2625-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:03.378Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11255": { "id": 11255, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 489535 }, "keywords": [], "label": "ford escort on the dufur stages of the Oregon trail rally", "type": "image", "content": "20170422-OTR2017-2400-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:04.838Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11256": { "id": 11256, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 345038 }, "keywords": [], "label": "Subaru 25rs on the duffer stage of Oregon trail rally", "type": "image", "content": "20170422-OTR2017-1942.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:06.090Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11257": { "id": 11257, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 281573 }, "keywords": [], "label": "Volvo rally car in the dust at Oregon trail rally", "type": "image", "content": "20170422-OTR2017-1361.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:07.264Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11258": { "id": 11258, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 218497 }, "keywords": [], "label": "portland night stages of Oregon trail rally", "type": "image", "content": "20170421-OTR-1081.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:08.345Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11259": { "id": 11259, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 288046 }, "keywords": [], "label": "portland night stages of the Oregon trail rally", "type": "image", "content": "20170421-OTR-1018.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:09.553Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11260": { "id": 11260, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 417229 }, "keywords": [], "label": "spectators on bleachers during sunset at race track", "type": "image", "content": "20170421-OTR-337.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:10.890Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11261": { "id": 11261, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 278720 }, "keywords": [], "label": "humorous cockpit of a rally car", "type": "image", "content": "20170421-OTR-17.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:12.279Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11262": { "id": 11262, "size": { "content": { "width": 1842, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 283893 }, "keywords": [], "label": "BMW alpina tribute car", "type": "image", "content": "20170225-CARS-AND-COFFEE-113.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:13.422Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11263": { "id": 11263, "size": { "content": { "width": 1736, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 344665 }, "keywords": [], "label": "front of modern corvette", "type": "image", "content": "20170225-CARS-AND-COFFEE-75.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:14.606Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11264": { "id": 11264, "size": { "content": { "width": 1555, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 187167 }, "keywords": [], "label": "vintage porsche 911", "type": "image", "content": "20170225-CARS-AND-COFFEE-53.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:15.712Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11265": { "id": 11265, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 482506 }, "keywords": [], "label": "front of yellow ford capri", "type": "image", "content": "20160903-ABFM-390.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:19.764Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11266": { "id": 11266, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328970 }, "keywords": [], "label": "series Land Rover fender", "type": "image", "content": "20160903-ABFM-321.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:20.968Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11267": { "id": 11267, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 300175 }, "keywords": [], "label": "original Land Rover fender", "type": "image", "content": "20160903-ABFM-287.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:23.005Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11268": { "id": 11268, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 306340 }, "keywords": [], "label": "early Land Rover front end", "type": "image", "content": "20160903-ABFM-272.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:24.146Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11269": { "id": 11269, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 329084 }, "keywords": [], "label": "cockpit of British open wheel race car", "type": "image", "content": "20160903-ABFM-181.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:25.567Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11270": { "id": 11270, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 242811 }, "keywords": [], "label": "ford lotus cortina rear", "type": "image", "content": "20160903-ABFM-46.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:26.956Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11271": { "id": 11271, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 394802 }, "keywords": [], "label": "lotus twin cam motor", "type": "image", "content": "20160903-ABFM-41.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:28.206Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11272": { "id": 11272, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 289733 }, "keywords": [], "label": "ford grand Torino GT", "type": "image", "content": "20160820-CARSANDCOFFEE-WOS-13.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:29.349Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11273": { "id": 11273, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 378956 }, "keywords": [], "label": "BMW 2000 steering wheel", "type": "image", "content": "20160808-CARS-AND-COFFEE-117.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:30.725Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11274": { "id": 11274, "size": { "content": { "width": 1583, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 308095 }, "keywords": [], "label": "vintage BMW 2000 front view", "type": "image", "content": "20160808-CARS-AND-COFFEE-110.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:31.894Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11275": { "id": 11275, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 336845 }, "keywords": [], "label": "vintage BMW sedan fender", "type": "image", "content": "20160808-CARS-AND-COFFEE-107.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:33.090Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11276": { "id": 11276, "size": { "content": { "width": 1630, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 382932 }, "keywords": [], "label": "vintage BMW sedan right", "type": "image", "content": "20160808-CARS-AND-COFFEE-105.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:34.339Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11277": { "id": 11277, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 528849 }, "keywords": [], "label": "ford lotus cortina", "type": "image", "content": "20160709-PORTLAND-HISTORICS-1013.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:36.644Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11278": { "id": 11278, "size": { "content": { "width": 1485, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 226119 }, "keywords": [], "label": "bmw CSL race car under track tent", "type": "image", "content": "20160709-PORTLAND-HISTORICS-14.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:37.939Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11279": { "id": 11279, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 274581 }, "keywords": [], "label": "painting of a porsche 911 in a grassy field", "type": "image", "content": "20160709-PORTLAND-HISTORICS-7.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:39.092Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-05-26T23:26:40.428Z", "searchable": true }, "11280": { "id": 11280, "size": { "content": { "width": 1368, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 276064 }, "keywords": [], "label": "fiat 500 front end", "type": "image", "content": "20160619-MICROCAR-SHOW-236.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:40.270Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11281": { "id": 11281, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198631 }, "keywords": [], "label": "citroen mehari beach car", "type": "image", "content": "20160619-MICROCAR-SHOW-177.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:41.454Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11282": { "id": 11282, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 221246 }, "keywords": [], "label": "interior of yellow foreign car", "type": "image", "content": "20160619-MICROCAR-SHOW-136.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:42.792Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11283": { "id": 11283, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 213135 }, "keywords": [], "label": "20160619-MICROCAR-SHOW-110", "type": "image", "content": "20160619-MICROCAR-SHOW-110.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:43.906Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11284": { "id": 11284, "size": { "content": { "width": 1739, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 478421 }, "keywords": [], "label": "pontiac trans am hood", "type": "image", "content": "20160601-PIR-CRUISE-IN-120.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:46.744Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11285": { "id": 11285, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 356971 }, "keywords": [], "label": "shady porsche 911 hood", "type": "image", "content": "20160423-VEHICLES-88.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-12T21:29:48.761Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11286": { "id": 11286, "searchable": true, "keywords": [], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 430256 }, "label": "toyota starlet twin cam 1600 motor", "type": "image", "content": "toyotastarlettwincam1600motor.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-05-26T23:28:34.573Z", "filters": [] }, "11287": { "id": 11287, "searchable": true, "keywords": [], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 375118 }, "label": "renault r5 turbo race car", "type": "image", "content": "renaultr5turboracecar.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-05-26T23:28:36.217Z", "filters": [], "key": "11287" }, "11288": { "id": 11288, "searchable": true, "keywords": [], "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 368441 }, "label": "audi sport quattro rally tail badge", "type": "image", "content": "audisportquattrorallytailbadge.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-05-26T23:28:37.298Z", "filters": [] }, "11289": { "id": 11289, "searchable": true, "keywords": [], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 370360 }, "label": "audi sport quattro rally front right corner", "type": "image", "content": "audisportquattrorallyfrontrightcorner.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-05-26T23:28:39.121Z", "filters": [] }, "11290": { "id": 11290, "searchable": true, "keywords": [], "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 493498 }, "label": "audi sport quattro rally front end", "type": "image", "content": "audisportquattrorallyfrontend.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-05-26T23:28:40.419Z", "filters": [], "key": "11290" }, "11291": { "id": 11291, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 280997 }, "keywords": [], "label": "audi sport quattro rally fender", "type": "image", "content": "audisportquattrorallyfender.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-05-26T23:28:41.713Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11292": { "id": 11292, "searchable": true, "keywords": [ "hanger", "plastic", "transparent", "animation", "gif", "liveaction", "still life", "product", "conceptual" ], "size": { "content": { "width": 900, "height": 1600 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 3067250 }, "label": "animation of clear plastic hangers", "type": "image", "content": "hanger-ani.gif", "thumb": "", "linkTarget": "", "caption": "column of plastic hangers hung on each other spinning", "overrides": {}, "featuredImage": "", "dateAdded": "2022-06-08T23:01:41.637Z", "filters": [], "key": "11292" }, "11293": { "id": 11293, "searchable": true, "keywords": [ "engine", "motor", "porsche", "flatsix", "boxer", "german", "aircooled" ], "size": { "content": { "width": 1450, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144361 }, "label": "porsche 911 motor on black", "type": "image", "content": "porsche-911-motor-on-black.jpg", "thumb": "", "linkTarget": "", "caption": "porsche 964 3.6 liter motor photographed on black background", "overrides": {}, "featuredImage": "", "dateAdded": "2022-06-08T23:33:14.490Z", "filters": [], "key": "11293" }, "11294": { "id": 11294, "searchable": true, "keywords": [ "automotive", "car", "emblem", "stilllife", "product", "photo", "pontiac", "chieftan" ], "size": { "content": { "width": 754, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 61011 }, "label": "pontiac-chieftan-hood-badge-on-black", "type": "image", "content": "pontiac-chieftan-hood-badge-on-black.jpg", "thumb": "", "linkTarget": "", "caption": "Pontiac chieftain hood ornament and emblem on black", "overrides": {}, "featuredImage": "", "dateAdded": "2022-06-08T23:35:52.127Z", "filters": [], "key": "11294" }, "11295": { "id": 11295, "searchable": true, "keywords": [ "found", "gloves", "cycling", "rainbow", "knolling", "oranzied", "stilllife", "photography", "jimgolden" ], "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 404150 }, "label": "94-gloves-found-while-cycling-jim-golden-thomas-scott", "type": "image", "content": "94-gloves-found-while-cycling-jim-golden-thomas-scott.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-07-15T17:49:22.563Z", "filters": [], "key": "11295" }, "11296": { "id": 11296, "searchable": true, "keywords": [ "vintage", "glass", "colorful", "bottles", "collection", "wheaton", "knolling", "thingsorganizedneatly", "flatlay", "layflat", "stilllife", "photography" ], "size": { "content": { "width": 1620, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 477099 }, "label": "vintage-wheaton-glass-bottlec-ollection", "type": "image", "content": "vintagewheatonglassbottlecollection.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-07-15T17:54:07.537Z", "filters": [], "key": "11296", "postDate": "2022-07-15T17:57:24.856Z" }, "11297": { "id": 11297, "searchable": true, "keywords": [ "vintage", "glass", "colorful", "bottles", "collection", "wheaton", "knolling", "thingsorganizedneatly", "flatlay", "layflat", "stilllife", "photography" ], "size": { "content": { "width": 1473, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 520818 }, "label": "colorful-glass-bottle-collection", "type": "image", "content": "colorfulglassbottlecollection.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-07-15T17:54:09.338Z", "filters": [], "key": "11297", "postDate": "2023-02-21T20:47:10.139Z" }, "11298": { "id": 11298, "searchable": true, "keywords": [ "vintage", "glass", "colorful", "bottles", "collection", "wheaton", "knolling", "thingsorganizedneatly", "flatlay", "layflat", "stilllife", "photography" ], "size": { "content": { "width": 1781, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 335904 }, "label": "colorful-glass-bottle-collection-rainbow", "type": "image", "content": "colorfulglassbottlecollectionrainbow.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-07-15T17:54:10.655Z", "filters": [], "key": "11298", "postDate": "2023-02-21T20:46:47.740Z" }, "11299": { "id": 11299, "searchable": true, "keywords": [ "vintage", "glass", "colorful", "bottles", "collection", "wheaton", "knolling", "thingsorganizedneatly", "flatlay", "layflat", "stilllife", "photography" ], "size": { "content": { "width": 1426, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 308189 }, "label": "backlit-glass-bottle-collection", "type": "image", "content": "backlitglassbottlecollection.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-07-15T17:54:12.348Z", "filters": [], "key": "11299", "postDate": "2022-07-15T17:57:24.856Z" }, "11300": { "id": 11300, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 404150 }, "keywords": [], "label": "z94-gloves-found-while-cycling-jim-golden-thomas-scott", "type": "image", "content": "z94-gloves-found-while-cycling-jim-golden-thomas-scott.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-07-15T17:59:57.753Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11301": { "id": 11301, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 378382 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-2-copy", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-2-copy.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:02.643Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:27.204Z" }, "11302": { "id": 11302, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 741672 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-4", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-4.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:04.752Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:25.252Z" }, "11303": { "id": 11303, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 355800 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-6", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-6.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:06.505Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:19.820Z" }, "11304": { "id": 11304, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 438697 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-8", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-8.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:08.361Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:17.628Z" }, "11305": { "id": 11305, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 525398 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-10", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-10.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:10.121Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:14.900Z" }, "11306": { "id": 11306, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 518787 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-12", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-12.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:11.601Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:12.708Z" }, "11307": { "id": 11307, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 839779 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-14", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-14.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:13.688Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:10.392Z" }, "11308": { "id": 11308, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 475384 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-16", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-16.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:15.259Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:07.532Z" }, "11309": { "id": 11309, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 345813 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-18", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-18.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:16.483Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:05.336Z" }, "11310": { "id": 11310, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 330347 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-20", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-20.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:17.677Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:17:03.316Z" }, "11311": { "id": 11311, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 395237 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-22", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-22.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:18.896Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:58.444Z" }, "11312": { "id": 11312, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 515797 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-24", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-24.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:20.739Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:55.868Z" }, "11313": { "id": 11313, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 350800 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-26", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-26.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:22.030Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:53.280Z" }, "11314": { "id": 11314, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 399692 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-28", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-28.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:23.279Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:50.839Z" }, "11315": { "id": 11315, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 512073 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-30", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-30.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:24.666Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:48.212Z" }, "11316": { "id": 11316, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 519465 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-32", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-32.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:26.536Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:45.508Z" }, "11317": { "id": 11317, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 609000 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-34", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-34.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:27.957Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:43.031Z" }, "11318": { "id": 11318, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 382885 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-36", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-36.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:29.315Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:15.243Z" }, "11319": { "id": 11319, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 256061 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-38", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-38.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:30.711Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:11.036Z" }, "11320": { "id": 11320, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328576 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-40", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-40.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:32.058Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:07.996Z" }, "11321": { "id": 11321, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 514344 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-42", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-42.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:37.286Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:05.224Z" }, "11322": { "id": 11322, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 558314 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-44", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-44.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:38.697Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:16:03.423Z" }, "11324": { "id": 11324, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 340885 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-48", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-48.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:41.803Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:56.119Z" }, "11325": { "id": 11325, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 326252 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-50", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-50.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:42.973Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:53.677Z" }, "11326": { "id": 11326, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 692479 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-52", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-52.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:44.950Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:51.821Z" }, "11327": { "id": 11327, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 713976 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-54", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-54.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:46.520Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:49.731Z" }, "11328": { "id": 11328, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 680522 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-56", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-56.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:48.418Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:47.487Z" }, "11329": { "id": 11329, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 713073 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-58", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-58.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:50.036Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:45.027Z" }, "11330": { "id": 11330, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 590172 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-60", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-60.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:54.468Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:42.799Z" }, "11331": { "id": 11331, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 323989 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-62", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-62.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:56.987Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:40.751Z" }, "11332": { "id": 11332, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 578669 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-64", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-64.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:04:59.783Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:38.215Z" }, "11333": { "id": 11333, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 654531 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-66", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-66.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:05:01.646Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:28.833Z" }, "11334": { "id": 11334, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 548833 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-68", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-68.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:05:03.652Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-01T22:15:23.488Z" }, "11335": { "id": 11335, "size": { "content": { "width": 1796, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 792947 }, "keywords": [], "label": "ONE-GOLDEN-SUMMER-Page-46-2", "type": "image", "content": "ONE-GOLDEN-SUMMER-Page-46-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-01T22:19:53.887Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11336": { "id": 11336, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 420372 }, "keywords": [], "label": "20220801-WALDRON-ISLAND-579", "type": "image", "content": "20220801-WALDRON-ISLAND-579.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:05.450Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-07T21:08:13.707Z" }, "11337": { "id": 11337, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 635905 }, "keywords": [ "oregn", "coast", "sunrise", "Jim golden" ], "label": "Sunrise at Radar beach on the Oregon coast", "type": "image", "content": "20220518-CAPE-MEARES-137.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:07.534Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11337", "searchable": true }, "11338": { "id": 11338, "searchable": true, "keywords": [ "Oregon", "coast", "cape meares", "beach", "sun", "fun", "summer" ], "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 574137 }, "label": "view of Cape Meares beach from above", "type": "image", "content": "20220705-CAPE-MEARES-41.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-09-03T22:20:08.928Z", "filters": [], "key": "11338" }, "11339": { "id": 11339, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 371526 }, "keywords": [ "oregon", "coast", "oceanside", "low tide", "beach", "sunrise", "cliffs" ], "label": "sunrise at oceanside beach on low tide", "type": "image", "content": "20220518-CAPE-MEARES-312.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:10.774Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11339", "searchable": true }, "11340": { "id": 11340, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 409881 }, "keywords": [ "driftwood", "ocean", "beach", "cloudy", "moody", "eastack" ], "label": "driftwood framing a rock in the ocean on a moody day", "type": "image", "content": "20220518-CAPE-MEARES-149.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:12.071Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11340", "searchable": true }, "11341": { "id": 11341, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 386413 }, "keywords": [], "label": "woman tanning on a lawn", "type": "image", "content": "test-3.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:13.276Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11341", "searchable": true }, "11342": { "id": 11342, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 207694 }, "keywords": [], "label": "people sleeping and group dinner", "type": "image", "content": "test-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:14.588Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11342", "searchable": true }, "11343": { "id": 11343, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269672 }, "keywords": [ "coast", "beach", "summer", "dog", "man", "hat" ], "label": "man wearing hat with dog on a beach", "type": "image", "content": "test-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:20:15.869Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11343", "searchable": true }, "11344": { "id": 11344, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Cape Meares Sunset", "type": "video", "content": "vimeo:manage/folders/12543934", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:38:36.024Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11345": { "id": 11345, "searchable": true, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 855, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Cape Meares Sunset", "type": "video", "content": "vimeo:746199945", "thumb": "20220831-SUMMER-5.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-09-03T22:48:17.324Z", "filters": [] }, "11346": { "id": 11346, "size": { "content": { "width": 415, "height": 739 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 15171485 }, "keywords": [], "label": "IMG_3177-high", "type": "image", "content": "IMG_3177-high.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-03T22:50:58.009Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11347": { "id": 11347, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 646, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Sunset Grass", "type": "video", "content": "vimeo:746210706", "thumb": "IMG_3810.jpg", "linkTarget": "", "dateAdded": "2022-09-04T19:38:47.365Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11348": { "id": 11348, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 853280 }, "keywords": [], "label": "lewis river Washington ", "type": "image", "content": "one-golden-summer-26.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:01:18.044Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11348", "searchable": true }, "11349": { "id": 11349, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 832611 }, "keywords": [], "label": "group photo friends on lake edge", "type": "image", "content": "20220826-TRILLIUM-102.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:29.572Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11349", "searchable": true }, "11350": { "id": 11350, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 346274 }, "keywords": [], "label": "view of mt hood from forest road", "type": "image", "content": "20220826-TRILLIUM-75.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:35.878Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11350", "searchable": true }, "11351": { "id": 11351, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 170653 }, "keywords": [], "label": "morning fog on alpine lake", "type": "image", "content": "20220826-TRILLIUM-14.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:37.044Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11351", "searchable": true }, "11352": { "id": 11352, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 488679 }, "keywords": [], "label": "mt hood from trillium lake at sunrise", "type": "image", "content": "20220826-TRILLIUM-11.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:38.634Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11352", "searchable": true }, "11353": { "id": 11353, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 697348 }, "keywords": [], "label": "girl jumping off middle falls lewis river", "type": "image", "content": "20220821-LOWER-FALLS-135.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:41.206Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11353", "searchable": true }, "11354": { "id": 11354, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 365416 }, "keywords": [], "label": "middle falls lewis river Washington ", "type": "image", "content": "20220821-LOWER-FALLS-194.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:42.817Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11354", "searchable": true }, "11355": { "id": 11355, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 417116 }, "keywords": [], "label": "sunlit pine tree", "type": "image", "content": "20220821-LOWER-FALLS-102.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:44.462Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11355", "searchable": true }, "11356": { "id": 11356, "size": { "content": { "width": 840, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 405129 }, "keywords": [], "label": "sand ripples at low tide", "type": "image", "content": "20220831-SUMMER-17.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:46.075Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11356", "searchable": true }, "11357": { "id": 11357, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 511861 }, "keywords": [], "label": "spooky cloud coming over mountain at the beach", "type": "image", "content": "20220816-CAPE-MEARES-10.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:49.343Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11357", "searchable": true }, "11358": { "id": 11358, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 616186 }, "keywords": [], "label": "group hanging out on beach San Juan Islands", "type": "image", "content": "20220801-WALDRON-199.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:52.192Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11358", "searchable": true }, "11359": { "id": 11359, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 586352 }, "keywords": [], "label": "20220801-WALDRON-291", "type": "image", "content": "20220801-WALDRON-291.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:55.129Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11360": { "id": 11360, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 428589 }, "keywords": [], "label": "sunny day on the water salish sea", "type": "image", "content": "20220801-WALDRON-166.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:57.584Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11360", "searchable": true }, "11361": { "id": 11361, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 454982 }, "keywords": [], "label": "two woman standing in the bay Waldron Island Washington", "type": "image", "content": "20220801-WALDRON-72.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:22:59.542Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11361", "searchable": true }, "11362": { "id": 11362, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 709346 }, "keywords": [], "label": "woman in doorway of barn Waldron Island ", "type": "image", "content": "20220801-WALDRON-103.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:02.972Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11362", "searchable": true }, "11363": { "id": 11363, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 316019 }, "keywords": [], "label": "Washington state ferry", "type": "image", "content": "20220801-WALDRON-ISLAND-466.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:06.417Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11363", "searchable": true }, "11364": { "id": 11364, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 399140 }, "keywords": [], "label": "coronado beach San Diego cloudy summer day", "type": "image", "content": "20220722-SAN-DIEGO-29.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:08.520Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11364", "searchable": true }, "11365": { "id": 11365, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 351387 }, "keywords": [], "label": "happy woman on beach at sunset Canada in the distance", "type": "image", "content": "20220801-WALDRON-310.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:11.683Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11365", "searchable": true }, "11366": { "id": 11366, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 296169 }, "keywords": [], "label": "native American cancers at sunset Waldron Island", "type": "image", "content": "20220801-WALDRON-390.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:13.428Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11366", "searchable": true }, "11367": { "id": 11367, "size": { "content": { "width": 850, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 420702 }, "keywords": [], "label": "lower falls lewis river Washington Jim golden", "type": "image", "content": "20220821-LOWER-FALLS-16.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:14.977Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11367", "searchable": true }, "11368": { "id": 11368, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 333132 }, "keywords": [], "label": "modern beachfront home on salishan spit", "type": "image", "content": "20220816-CAPE-MEARES-63.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:16.771Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11368", "searchable": true }, "11369": { "id": 11369, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 571441 }, "keywords": [], "label": "dune erosion on Oregon coast", "type": "image", "content": "20220816-CAPE-MEARES-42.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:20.982Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11369", "searchable": true }, "11370": { "id": 11370, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 453727 }, "keywords": [ "Jim golden", "beach", "summer", "san diego", "blacks beach" ], "label": "view of cliffs from blacks beach on a summer day Jim golden", "type": "image", "content": "20220722-SAN-DIEGO-54.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:26.985Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11370", "searchable": true }, "11371": { "id": 11371, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 739521 }, "keywords": [ "volcano", "crater", "mt st helens", "washington", "wildflowers", "summer", "hike" ], "label": "view of mt st helens looking south into the crater", "type": "image", "content": "20220712-MT-ST-HELENS-13.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:31.083Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11371", "searchable": true }, "11372": { "id": 11372, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 247361 }, "keywords": [], "label": "summer sunset through trees Waldron Island Washington ", "type": "image", "content": "one-golden-summer-9.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:32.727Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11372", "searchable": true }, "11373": { "id": 11373, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 404445 }, "keywords": [], "label": "dog truck and woman on Waldron Island", "type": "image", "content": "one-golden-summer-8.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:34.605Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11373", "searchable": true }, "11374": { "id": 11374, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 216240 }, "keywords": [], "label": "woman on baat in the Salish sea", "type": "image", "content": "one-golden-summer-7.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:36.300Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11374", "searchable": true }, "11375": { "id": 11375, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 360902 }, "keywords": [], "label": "walking to black beach on a summer day", "type": "image", "content": "one-golden-summer-6.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:37.900Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11375", "searchable": true }, "11376": { "id": 11376, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 340131 }, "keywords": [], "label": "one-golden-summer-5", "type": "image", "content": "one-golden-summer-5.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:40.165Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11377": { "id": 11377, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144551 }, "keywords": [], "label": "one-golden-summer-4", "type": "image", "content": "one-golden-summer-4.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:42.329Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11378": { "id": 11378, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 389950 }, "keywords": [], "label": "pile of floating tubes summer lake", "type": "image", "content": "one-golden-summer-29.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:44.113Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11378", "searchable": true }, "11379": { "id": 11379, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 265325 }, "keywords": [], "label": "we miss you mom sign", "type": "image", "content": "one-golden-summer-28.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:46.123Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11379", "searchable": true }, "11380": { "id": 11380, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196371 }, "keywords": [], "label": "dog sleeping in tent", "type": "image", "content": "one-golden-summer-27.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:47.517Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11380", "searchable": true }, "11381": { "id": 11381, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 238580 }, "keywords": [], "label": "bike leaned against tree in forest", "type": "image", "content": "one-golden-summer-25.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:48.757Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11381", "searchable": true }, "11382": { "id": 11382, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 282701 }, "keywords": [], "label": "sleeping dog in patch of ferns", "type": "image", "content": "one-golden-summer-24.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:50.030Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11382", "searchable": true }, "11383": { "id": 11383, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 165950 }, "keywords": [], "label": "one-golden-summer-23", "type": "image", "content": "one-golden-summer-23.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:51.283Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11384": { "id": 11384, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 117764 }, "keywords": [], "label": "one-golden-summer-22", "type": "image", "content": "one-golden-summer-22.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:53.070Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11385": { "id": 11385, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 357114 }, "keywords": [], "label": "woman sunbathing topless on beach dune with jeep", "type": "image", "content": "one-golden-summer-21.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:54.442Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11385", "searchable": true }, "11386": { "id": 11386, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 562942 }, "keywords": [], "label": "montage of painting a house in summer", "type": "image", "content": "one-golden-summer-20.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:56.878Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11386", "searchable": true }, "11387": { "id": 11387, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 222009 }, "keywords": [], "label": "rowing boat approaching shore sunset Waldron island", "type": "image", "content": "one-golden-summer-19.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:23:58.604Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11387", "searchable": true }, "11388": { "id": 11388, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269523 }, "keywords": [], "label": "woman and dog in back of pickup truck summer day", "type": "image", "content": "one-golden-summer-18.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:00.169Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11388", "searchable": true }, "11389": { "id": 11389, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 456006 }, "keywords": [], "label": "man in vintage yellow truck", "type": "image", "content": "one-golden-summer-17.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:01.577Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11389", "searchable": true }, "11390": { "id": 11390, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 447087 }, "keywords": [], "label": "orange flowers in summer garden", "type": "image", "content": "one-golden-summer-16.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:03.039Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11390", "searchable": true }, "11391": { "id": 11391, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 281060 }, "keywords": [], "label": "sunset paddle board on Waldron Island ", "type": "image", "content": "one-golden-summer-15.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:05.170Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11391", "searchable": true }, "11392": { "id": 11392, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 286594 }, "keywords": [], "label": "one-golden-summer-14", "type": "image", "content": "one-golden-summer-14.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:07.320Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11393": { "id": 11393, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 353455 }, "keywords": [], "label": "wet dog climbing out of the water Waldron Island", "type": "image", "content": "one-golden-summer-13.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:08.857Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11393", "searchable": true }, "11394": { "id": 11394, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 222938 }, "keywords": [], "label": "man driving a powerboat Waldron Island ", "type": "image", "content": "one-golden-summer-12.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:10.245Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11394", "searchable": true }, "11395": { "id": 11395, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 291030 }, "keywords": [], "label": "Boty in back of pickup truck Waldron Island Jim golden", "type": "image", "content": "one-golden-summer-11.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:11.798Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11395", "searchable": true }, "11396": { "id": 11396, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198481 }, "keywords": [], "label": "woman and dog on dock at sunset Waldron Island", "type": "image", "content": "one-golden-summer-10.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:24:13.467Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11396", "searchable": true }, "11397": { "id": 11397, "size": { "content": { "width": 760, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 358903 }, "keywords": [], "label": "sunset on the lewis rover trail Washington ", "type": "image", "content": "20220821-LOWER-FALLS-150.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:47:03.097Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11397", "searchable": true }, "11398": { "id": 11398, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 525471 }, "keywords": [], "label": "mt adams wilderness Washington ", "type": "image", "content": "20220826-TRILLIUM-80.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:48:47.506Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11398", "searchable": true }, "11399": { "id": 11399, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 199675 }, "keywords": [], "label": "one-golden-summer-22x", "type": "image", "content": "one-golden-summer-22x.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-04T21:55:43.755Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11400": { "id": 11400, "searchable": true, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 765, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Lower Falls", "type": "video", "content": "vimeo:746211094", "thumb": "IMG_3832.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-09-04T22:01:15.254Z", "filters": [] }, "11401": { "id": 11401, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 764, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Low Tide", "type": "video", "content": "vimeo:746211032", "thumb": "IMG_3828.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:05:46.122Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11402": { "id": 11402, "searchable": true, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 753, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Sunset Water Tickle", "type": "video", "content": "vimeo:746211068", "thumb": "IMG_3830.jpg", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2022-09-04T22:06:39.296Z", "filters": [] }, "11403": { "id": 11403, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 754, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Tribal Canoe at Sunset", "type": "video", "content": "vimeo:746210891", "thumb": "IMG_3822.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:10:05.288Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11404": { "id": 11404, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 645, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Cashish Jumper", "type": "video", "content": "vimeo:746210776", "thumb": "IMG_3814.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:12:27.428Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11405": { "id": 11405, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 732, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Island Magic", "type": "video", "content": "vimeo:746210836", "thumb": "IMG_3819.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:13:28.662Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11406": { "id": 11406, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 778, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Sunset at Tibbs", "type": "video", "content": "vimeo:746210878", "thumb": "IMG_3821.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:14:50.883Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11407": { "id": 11407, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 739, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Windy Wives", "type": "video", "content": "vimeo:746210744", "thumb": "20220831-SUMMER-1-6.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:16:12.729Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11408": { "id": 11408, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 765, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Reggage Roll Around", "type": "video", "content": "vimeo:746210660", "thumb": "IMG_3836.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:18:43.910Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11409": { "id": 11409, "size": { "content": { "width": 0, "height": 0 }, "thumb": { "width": 755, "height": 1140 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 0 }, "label": "Going Off the Rock", "type": "video", "content": "vimeo:746210949", "thumb": "IMG_3824.jpg", "linkTarget": "", "dateAdded": "2022-09-04T22:20:22.498Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11410": { "id": 11410, "size": { "content": { "width": 503, "height": 754 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 11234997 }, "keywords": [], "label": "dog rolling in green grass Kelso", "type": "image", "content": "KELSO.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T20:29:20.290Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-07T21:05:12.687Z", "key": "11410", "searchable": true }, "11411": { "id": 11411, "size": { "content": { "width": 427, "height": 640 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 8598250 }, "keywords": [ "ocean", "grass", "sunset", "orange", "gold", "blue", "beach" ], "label": "dune grass at sunset ", "type": "image", "content": "SUNSET-GRASS.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T20:33:42.701Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11411", "searchable": true }, "11414": { "id": 11414, "size": { "content": { "width": 510, "height": 766 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 12353317 }, "keywords": [], "label": "GIF of sunset with mountains and dune grass", "type": "image", "content": "SUNSET-LOOKING-NORTH-JULY.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T20:58:34.455Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-07T21:06:14.291Z", "key": "11414", "searchable": true }, "11415": { "id": 11415, "size": { "content": { "width": 589, "height": 884 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 14558398 }, "keywords": [], "label": "two women on ferry deck windy", "type": "image", "content": "WINDY-WIVES.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:03:10.017Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2022-09-07T21:05:08.594Z", "key": "11415", "searchable": true }, "11416": { "id": 11416, "size": { "content": { "width": 540, "height": 540 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 4615504 }, "keywords": [], "label": "CASH-JUMPER", "type": "image", "content": "CASH-JUMPER.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:16:00.087Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11417": { "id": 11417, "size": { "content": { "width": 548, "height": 822 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 7300254 }, "keywords": [], "label": "GIF of kid jumping off dock Waldron island", "type": "image", "content": "CASHISH-JUMPER.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:19:58.390Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11417", "searchable": true }, "11418": { "id": 11418, "size": { "content": { "width": 521, "height": 782 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 13516892 }, "keywords": [], "label": "glistening ocean on a summer day", "type": "image", "content": "ISLAND-MAGIC.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:22:50.056Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11418", "searchable": true }, "11419": { "id": 11419, "size": { "content": { "width": 640, "height": 640 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 11668600 }, "keywords": [], "label": "animation of ocean water at sunset", "type": "image", "content": "SUNSET-WATER-TIBBS.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:25:32.941Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11419", "searchable": true }, "11420": { "id": 11420, "size": { "content": { "width": 539, "height": 808 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 12159944 }, "keywords": [], "label": "bike in the back of a moving boat", "type": "image", "content": "GOING-OFF.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:36:15.841Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11420", "searchable": true }, "11421": { "id": 11421, "size": { "content": { "width": 640, "height": 960 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 14677545 }, "keywords": [], "label": "animation of low tide water at the beach", "type": "image", "content": "LOW-TIDE.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:48:21.621Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11421", "searchable": true }, "11422": { "id": 11422, "size": { "content": { "width": 427, "height": 640 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 9358356 }, "keywords": [], "label": "sunset at ocean beach Jim golden", "type": "image", "content": "SUNSET-SPLASH.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:48:28.398Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11422", "searchable": true }, "11423": { "id": 11423, "size": { "content": { "width": 427, "height": 640 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 19076785 }, "keywords": [], "label": "lower falls lewis river Washington state", "type": "image", "content": "LOWER-FALLS.gif", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T21:48:39.126Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11423", "searchable": true }, "11424": { "id": 11424, "size": { "content": { "width": 1860, "height": 1240 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 668006 }, "keywords": [], "label": "woman and dog on coast of Waldron island", "type": "image", "content": "20220801-WALDRON-264.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T22:22:22.493Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11424", "searchable": true }, "11425": { "id": 11425, "size": { "content": { "width": 1860, "height": 1240 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 850665 }, "keywords": [ "xmp.did:33252e81-3317-4e43-bff6-d4ecc4694919" ], "label": "woman and dog on rocky island coast ", "type": "image", "content": "20220801-WALDRON-276.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T22:22:24.847Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11425", "searchable": true }, "11426": { "id": 11426, "size": { "content": { "width": 1860, "height": 1240 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 906900 }, "keywords": [ "cabin", "Salish sea", "Waldron island", "ocean", "beach", "san juans" ], "label": "June Burn cabin Waldron Island", "type": "image", "content": "20220801-WALDRON-163.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T22:24:34.142Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11426", "searchable": true }, "11427": { "id": 11427, "size": { "content": { "width": 1860, "height": 1240 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 797536 }, "keywords": [], "label": "WALDRON-ISLAND Washington", "type": "image", "content": "20220801-WALDRON-ISLAND-478.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T22:24:38.003Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11428": { "id": 11428, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 268113 }, "keywords": [], "label": "sunset on Waldron Island Jim Golden", "type": "image", "content": "20220801-WALDRON-ISLAND-579-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-07T22:33:23.891Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11428", "searchable": true }, "11429": { "id": 11429, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 216012 }, "keywords": [ "beach", "coast", "oregon", "buoy", "Jim golden" ], "label": "Buoy in sea foam on sandy beach", "type": "image", "content": "one-golden-summer-30.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-08T18:23:53.416Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11429", "searchable": true }, "11430": { "id": 11430, "size": { "content": { "width": 930, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 298813 }, "keywords": [], "label": "woman with kayaks summer lake", "type": "image", "content": "one-golden-summer-31.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2022-09-08T23:11:07.728Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11430", "searchable": true }, "11431": { "id": 11431, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 370289 }, "keywords": [], "label": "KEEN_LIFESTYLE_WOMENTRAVELLERS", "type": "image", "content": "KEEN_LIFESTYLE_WOMENTRAVELLERS.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-02-21T20:38:23.344Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11432": { "id": 11432, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 388283 }, "keywords": [], "label": "KEEN_LIFESTYLE_DIY", "type": "image", "content": "KEEN_LIFESTYLE_DIY.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-02-21T20:38:24.385Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11433": { "id": 11433, "size": { "content": { "width": 1533, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 381112 }, "keywords": [], "label": "20160109-WRIGHT-ARCHITECTURE-SBI-46", "type": "image", "content": "20160109-WRIGHT-ARCHITECTURE-SBI-46.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:50:59.158Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11434": { "id": 11434, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 499948 }, "keywords": [], "label": "20160109-WRIGHT-ARCHITECTURE-SBI-22", "type": "image", "content": "20160109-WRIGHT-ARCHITECTURE-SBI-22.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:02.468Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11435": { "id": 11435, "size": { "content": { "width": 1429, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 359511 }, "keywords": [], "label": "20160109-WRIGHT-ARCHITECTURE-SBI-18", "type": "image", "content": "20160109-WRIGHT-ARCHITECTURE-SBI-18.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:04.403Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11436": { "id": 11436, "size": { "content": { "width": 860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 138673 }, "keywords": [], "label": "20170723-WA-PARKSIDE-47-2", "type": "image", "content": "20170723-WA-PARKSIDE-47-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:05.694Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11437": { "id": 11437, "size": { "content": { "width": 1527, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 355593 }, "keywords": [], "label": "20170723-WA-PARKSIDE-467-Edit", "type": "image", "content": "20170723-WA-PARKSIDE-467-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:07.632Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11438": { "id": 11438, "size": { "content": { "width": 753, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150551 }, "keywords": [], "label": "20170723-WA-PARKSIDE-234-2-Edit", "type": "image", "content": "20170723-WA-PARKSIDE-234-2-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:09.619Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11439": { "id": 11439, "size": { "content": { "width": 889, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 182932 }, "keywords": [], "label": "20170723-WA-PARKSIDE-134-2-Edit", "type": "image", "content": "20170723-WA-PARKSIDE-134-2-Edit.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:11.294Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11440": { "id": 11440, "size": { "content": { "width": 1860, "height": 1109 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 526500 }, "keywords": [], "label": "20170924-WA-MOD-DOM-EXT-55", "type": "image", "content": "20170924-WA-MOD-DOM-EXT-55.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:13.841Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11441": { "id": 11441, "size": { "content": { "width": 1656, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 600785 }, "keywords": [], "label": "20170417-WA-MOD-DOM-INT-91", "type": "image", "content": "20170417-WA-MOD-DOM-INT-91.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:15.585Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11442": { "id": 11442, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 465652 }, "keywords": [], "label": "20170417-WA-MOD-DOM-INT-45-HDR", "type": "image", "content": "20170417-WA-MOD-DOM-INT-45-HDR.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:18.028Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11443": { "id": 11443, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 437256 }, "keywords": [], "label": "WDO_ATOMIC_RANCH-74", "type": "image", "content": "WDO_ATOMIC_RANCH-74.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:19.678Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11444": { "id": 11444, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 369223 }, "keywords": [], "label": "WDO_ATOMIC_RANCH-29", "type": "image", "content": "WDO_ATOMIC_RANCH-29.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:21.329Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11445": { "id": 11445, "size": { "content": { "width": 1710, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 379305 }, "keywords": [], "label": "WDO_ATOMIC_RANCH-12", "type": "image", "content": "WDO_ATOMIC_RANCH-12.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:23.270Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11446": { "id": 11446, "size": { "content": { "width": 1846, "height": 735 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 307979 }, "keywords": [], "label": "WDO_ATOMIC_RANCH-106", "type": "image", "content": "WDO_ATOMIC_RANCH-106.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T18:51:24.570Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11447": { "id": 11447, "size": { "content": { "width": 1024, "height": 682 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 72656 }, "keywords": [], "label": "LAST-RESORT-1", "type": "image", "content": "LAST-RESORT-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T19:20:52.228Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11448": { "id": 11448, "size": { "content": { "width": 1024, "height": 682 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 85056 }, "keywords": [], "label": "LAST-RESORT-2", "type": "image", "content": "LAST-RESORT-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T19:20:53.995Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11449": { "id": 11449, "size": { "content": { "width": 1024, "height": 683 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 129862 }, "keywords": [], "label": "LAST-RESORT-3", "type": "image", "content": "LAST-RESORT-3.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T19:20:55.488Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11449" }, "11450": { "id": 11450, "size": { "content": { "width": 1024, "height": 682 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 93368 }, "keywords": [], "label": "LAST-RESORT-4", "type": "image", "content": "LAST-RESORT-4.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T19:20:57.184Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11451": { "id": 11451, "size": { "content": { "width": 1024, "height": 593 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 78216 }, "keywords": [], "label": "LAST-RESORT-5", "type": "image", "content": "LAST-RESORT-5.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-04-11T19:20:58.842Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11452": { "id": 11452, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 85947 }, "keywords": [], "label": "harley-davidson holiday gift stack", "type": "image", "content": "harley-davidson-holiday-gift-stack.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:13.198Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11452", "searchable": true }, "11453": { "id": 11453, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 262503 }, "keywords": [], "label": "harley-davidson motorcycle apparel", "type": "image", "content": "harley-davidson-motorcycle-apparel.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:14.205Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11454": { "id": 11454, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 229458 }, "keywords": [], "label": "orange and black harley-davidson motorcycle accesories", "type": "image", "content": "harley-davidson-motorcycle-accesories.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:15.461Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11455": { "id": 11455, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 215983 }, "keywords": [], "label": "harley-davidson orange and black homegoods", "type": "image", "content": "harley-davidson-moto-homegoods.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:16.946Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11456": { "id": 11456, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 256837 }, "keywords": [], "label": "harley-davidson motorcycle gear orange black ", "type": "image", "content": "harley-davidson-motorcycle-gear.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:18.600Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11456" }, "11457": { "id": 11457, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 186229 }, "keywords": [], "label": "harley-davidson motocycle apparel", "type": "image", "content": "harley-davidson-moto-apparel.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:19.987Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11458": { "id": 11458, "size": { "content": { "width": 1506, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 247165 }, "keywords": [], "label": "harley-davidson motorcycle parts", "type": "image", "content": "harley-davidson-motorcycle-parts.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2023-12-06T23:24:21.624Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11459": { "id": 11459, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 444345 }, "keywords": [], "label": " summer ice cream fun pink berry jim golden", "type": "image", "content": "saltandstrawsummericecreamfunpinkberry.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:18:07.686Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11459" }, "11460": { "id": 11460, "size": { "content": { "width": 811, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 174590 }, "keywords": [], "label": "summer berry smash slab pie blue red pink", "type": "image", "content": "saltandstrawsummerberrysmashslabpieblueredpink.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:18:44.380Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11460", "searchable": true }, "11461": { "id": 11461, "size": { "content": { "width": 1860, "height": 803 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 555627 }, "keywords": [], "label": "picnic sun fun ice cream picnic ", "type": "image", "content": "saltandstrawsummerpicnicsunfunicecreamwoodtable.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:19:22.453Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11461" }, "11462": { "id": 11462, "size": { "content": { "width": 1039, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 366058 }, "keywords": [], "label": "ice cream cones under brewers taps Jim Golden", "type": "image", "content": "saltandstrawbrewersseriesbeericecreamsummer.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:25:17.507Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11462", "searchable": true }, "11463": { "id": 11463, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 344357 }, "keywords": [], "label": "ice cream cone on chalkboard background", "type": "image", "content": "saltandstrawbrewersseriesbeericecreamsummerBreakside.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:25:18.719Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11464": { "id": 11464, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 339520 }, "keywords": [], "label": "salt and straw brewers series beer ice cream summer", "type": "image", "content": "saltandstrawbrewersseriesbeericecreamsummerLaTropical.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:25:20.153Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11465": { "id": 11465, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 328428 }, "keywords": [], "label": "salt and straw brewers series beer ice cream summer", "type": "image", "content": "saltandstrawbrewersseriesbeericecreamsummerRussian.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:25:21.409Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11466": { "id": 11466, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 707252 }, "keywords": [], "label": "fall harvest ice cream orange gold", "type": "image", "content": "saltandstrawfallharvesticecreamorangegold.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:47:16.436Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11466" }, "11467": { "id": 11467, "size": { "content": { "width": 1573, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 587363 }, "keywords": [ "fall", "harvest", "pumpkin", "ginger", "ice cream" ], "label": "fall harvest ice cream apple pumpkin ginger", "type": "image", "content": "saltandstrawfallharvesticecreamapplepumpkinginger.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:47:18.798Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11467" }, "11468": { "id": 11468, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 409427 }, "keywords": [], "label": "spooky halloween salt and straw image", "type": "image", "content": "saltandstrawoctoberhalloweenblackskullssnakesscary.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:48:05.825Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11468" }, "11469": { "id": 11469, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 259403 }, "keywords": [], "label": "minimal still life of wine bottles and fruit on harvest colored background", "type": "image", "content": "saltandstrawfallharvesticecreampearanise.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:48:11.499Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11469", "searchable": true }, "11470": { "id": 11470, "size": { "content": { "width": 1106, "height": 580 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196535 }, "keywords": [], "label": "cold holiday ice cream cones mittens salt and straw", "type": "image", "content": "saltandstrawholidaycoldmittenssnowflakeicecream.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:51:18.237Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11471": { "id": 11471, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 541915 }, "keywords": [ "holiday", "party", "mess", "festive", "green", "red", "cahmpagne" ], "label": "holiday party aftermath for salt and straw ice cream Jim Golden", "type": "image", "content": "saltandstrawholidaypartyaftermathmesswintericecream.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:51:20.113Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11471", "searchable": true }, "11472": { "id": 11472, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 652727 }, "keywords": [ "ice cream cake", "cake", "salt and straw", "dwanta" ], "label": "festive holiday image of solar and straw ice cream cake", "type": "image", "content": "saltandstrawholidaydwantasantaicecreamcake.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:52:35.022Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11473": { "id": 11473, "size": { "content": { "width": 1424, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 89891 }, "keywords": [], "label": "saltandstrawholidaydwantasantaicecreamcaketeasertwinpeaks", "type": "image", "content": "saltandstrawholidaydwantasantaicecreamcaketeasertwinpeaks.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T21:52:36.720Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11474": { "id": 11474, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 427597 }, "keywords": [ "knolling", "things organized neatly", "collection" ], "label": "collection of holistic products Jim Golden", "type": "image", "content": "lovedotcomproductphotography..jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:05:47.480Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11475": { "id": 11475, "size": { "content": { "width": 1860, "height": 920 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 225492 }, "keywords": [], "label": "colorful houseware products Jim Golden", "type": "image", "content": "lovedotcomhomegoodsphotography.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:05:49.887Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true, "key": "11475" }, "11476": { "id": 11476, "size": { "content": { "width": 1450, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 135840 }, "keywords": [ "Jim golden", "porsche 911", "motor", "enegine", "classic", "car", "automotive" ], "label": "flat six porsche 911 motor in a dark and moody environment Jim Golden", "type": "image", "content": "porsche911motorspecimendarkmoody.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:10:28.752Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11476", "searchable": true }, "11477": { "id": 11477, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 150974 }, "keywords": [ "motor", "porsche", "dark", "moody", "911", "cars", "automotive" ], "label": "dark moody picture of classic porsche 911 motor Jim Golden", "type": "image", "content": "porsche911motorracingclassicflatsixmoodydark.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:10:31.383Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11477", "searchable": true }, "11479": { "id": 11479, "size": { "content": { "width": 805, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 73855 }, "keywords": [], "label": "ahnu-footwear-sole-technology-black-white-grey", "type": "image", "content": "ahnufootwearsoletechnologyblackwhitegrey.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:54:55.004Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11480": { "id": 11480, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 191771 }, "keywords": [ "ahnu", "fashion footwear", "sneaker", "trainer", "Jim golden" ], "label": "ahnu fashion forward footwear Jim Golden", "type": "image", "content": "ahnufootwearhokauggteva.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:54:56.067Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11481": { "id": 11481, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 301215 }, "keywords": [ "ahnu sneaker tech shoe footwear Jim Golden" ], "label": "ahnu sneaker tech shoe footwear Jim Golden", "type": "image", "content": "ahnusneakertechshoe.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:54:57.404Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11482": { "id": 11482, "searchable": true, "keywords": [], "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 230663 }, "label": "ahnu trainer fashion forward walking shoe", "type": "image", "content": "ahnutrainerfashionforwardwalkingshoe.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2024-06-27T22:54:58.599Z", "filters": [], "key": "11482" }, "11483": { "id": 11483, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 67748 }, "keywords": [], "label": "cream colored running shoe Jim golden", "type": "image", "content": "AHNU-SEQUENCE-LOW2-HERO-1-0303.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:56:34.171Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11484": { "id": 11484, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 89630 }, "keywords": [ "footwear", "ahnu", "trainer", "neaker" ], "label": "moody image of a fashion forward running shoe", "type": "image", "content": "AHNU-SEQUENCE-LOW2-HERO-2-0361.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T22:57:03.017Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11485": { "id": 11485, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 244816 }, "keywords": [], "label": "moody black sneaker image Jim golden", "type": "image", "content": "AHNU-SEQ-BLK-REFL-LOW-DET-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T23:14:13.723Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11486": { "id": 11486, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 290928 }, "keywords": [], "label": "lace line detail on black tennis shoe", "type": "image", "content": "AHNU-SEQ-BLK-REFL-LOW-DET-2.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T23:14:14.806Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11487": { "id": 11487, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 246587 }, "keywords": [], "label": "recycled gum sole on a black sneaker Jim golden", "type": "image", "content": "AHNU-SEQ-BLK-REFL-LOW-DET-3.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T23:14:15.926Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11488": { "id": 11488, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 66911 }, "keywords": [], "label": "fashion forward walking shoe Jim Golden ", "type": "image", "content": "AHNU-SEQ-BLK-REFL-LOW-HERO-1.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2024-06-27T23:14:17.029Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "searchable": true }, "11489": { "id": 11489, "size": { "content": { "width": 876, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 170762 }, "keywords": [ "ice cream", "heart", "valentines day", "chocolates", "pink" ], "label": " ice cream cones in heart shaped valentines box", "type": "image", "content": "icecreamconesinheartshapedbox.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2025-03-17T19:18:41.631Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11489", "searchable": true }, "11490": { "id": 11490, "size": { "content": { "width": 1184, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 1763027 }, "keywords": [], "label": "SnS-valentines-heart-animation", "type": "image", "content": "SnS-valentines-heart-animation.gif", "thumb": "", "linkTarget": "", "dateAdded": "2025-03-17T19:19:05.109Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11491": { "id": 11491, "searchable": true, "keywords": [ "footwear", "sketch", "sunset", "muddy", "worn" ], "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 208582 }, "label": "running shoe hanging on sunset background blue orange", "type": "image", "content": "runningshoehangingonsunsetbackgroundblueorange.jpg", "thumb": "", "linkTarget": "", "caption": "", "overrides": {}, "featuredImage": "", "dateAdded": "2025-03-20T22:20:40.574Z", "filters": [], "key": "11491" }, "11492": { "id": 11492, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 810534 }, "keywords": [], "label": "20211231-CAPE-MEARES-NYE-65", "type": "image", "content": "20211231-CAPE-MEARES-NYE-65.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2025-08-20T22:42:01.120Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11493": { "id": 11493, "size": { "content": { "width": 1860, "height": 1135 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 381936 }, "keywords": [], "label": "valentines-day-saltandstraw-icecream", "type": "image", "content": "valentines-day-saltandstraw-icecream.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T21:59:41.882Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11494": { "id": 11494, "size": { "content": { "width": 1786, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 493709 }, "keywords": [], "label": "summer-picnic-icecream-saltandstraw", "type": "image", "content": "summer-picnic-icecream-saltandstraw.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:00:20.369Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11494" }, "11495": { "id": 11495, "size": { "content": { "width": 1853, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 426674 }, "keywords": [], "label": "summer-berries-flavors-saltandstraw", "type": "image", "content": "summer-berries-flavors-saltandstraw.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:00:22.761Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11495" }, "11496": { "id": 11496, "size": { "content": { "width": 1860, "height": 1057 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 393725 }, "keywords": [], "label": "fall-flavors-saltstraw-harvest", "type": "image", "content": "fall-flavors-saltstraw-harvest.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:01:01.792Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11496" }, "11497": { "id": 11497, "size": { "content": { "width": 1761, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 449317 }, "keywords": [], "label": "brewers-series-flavors-saltandstraw", "type": "image", "content": "brewers-series-flavors-saltandstraw.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:01:28.464Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11498": { "id": 11498, "size": { "content": { "width": 1860, "height": 1089 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 446588 }, "keywords": [], "label": "holiday-icecream-flavors-saltstraw", "type": "image", "content": "holiday-icecream-flavors-saltstraw.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:02:16.833Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11499": { "id": 11499, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 547229 }, "keywords": [], "label": "asianchickenstirfrycampingoutdoors", "type": "image", "content": "asianchickenstirfrycampingoutdoors.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:03:53.510Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11500": { "id": 11500, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 593533 }, "keywords": [], "label": "italianlunchbowllasagnacamping", "type": "image", "content": "italianlunchbowllasagnacamping.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:03:56.543Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11501": { "id": 11501, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 363176 }, "keywords": [], "label": "bowhunterlunchbowlfettucine", "type": "image", "content": "bowhunterlunchbowlfettucine.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:03:59.277Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11502": { "id": 11502, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 460763 }, "keywords": [], "label": "rockclimberlunchbowl", "type": "image", "content": "rockclimberlunchbowl.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:04:01.369Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11502" }, "11503": { "id": 11503, "size": { "content": { "width": 1234, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 382280 }, "keywords": [], "label": "mountainhousepackagingimageryjimgolden", "type": "image", "content": "mountainhousepackagingimageryjimgolden.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:04:23.603Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11504": { "id": 11504, "size": { "content": { "width": 1860, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 371828 }, "keywords": [], "label": "mountain-house-packaging-bowls-overhead", "type": "image", "content": "mountain-house-packaging-bowls-overhead.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:05:48.851Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11505": { "id": 11505, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 134512 }, "keywords": [], "label": "armitron-robot-arm-toy-1980s", "type": "image", "content": "armitron-robot-arm-toy-1980s.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:07:48.077Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11505" }, "11506": { "id": 11506, "size": { "content": { "width": 928, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 175671 }, "keywords": [], "label": "parts-armitron-robot-arm-on-yellow", "type": "image", "content": "parts-armitron-robot-arm-on-yellow.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-01-13T22:07:50.560Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11506" }, "11507": { "id": 11507, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 270749 }, "keywords": [], "label": "water-shoe-teva-sandal-on-west-rocks", "type": "image", "content": "water-shoe-teva-sandal-on-west-rocks.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:09:01.283Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11507" }, "11508": { "id": 11508, "size": { "content": { "width": 1860, "height": 1046 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 378655 }, "keywords": [], "label": "teva-adventure-sandal-on-mossy-rocks-greens-greys", "type": "image", "content": "teva-adventure-sandal-on-mossy-rocks-greens-greys.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:09:02.996Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11508" }, "11509": { "id": 11509, "size": { "content": { "width": 1860, "height": 1046 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 349677 }, "keywords": [], "label": "red-rock-desert-oasis-teva-adventure-sandal", "type": "image", "content": "red-rock-desert-oasis-teva-adventure-sandal.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:09:04.011Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11509" }, "11510": { "id": 11510, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 269064 }, "keywords": [], "label": "yellow-red-grey-vintage-GMC-truck", "type": "image", "content": "yellow-red-grey-vintage-GMC-truck.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:35.985Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11510" }, "11511": { "id": 11511, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 226270 }, "keywords": [], "label": "vintage-pedal-car-with-smile-face", "type": "image", "content": "vintage-pedal-car-with-smile-face.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:37.775Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11511" }, "11512": { "id": 11512, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 453800 }, "keywords": [], "label": "vintage-go-cart-on-top-of-golf-cart-flea-market", "type": "image", "content": "vintage-go-cart-on-top-of-golf-cart-flea-market.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:39.401Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11512" }, "11513": { "id": 11513, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 367050 }, "keywords": [], "label": "vintage-canoe-and-paddles-green-blue-wood", "type": "image", "content": "vintage-canoe-and-paddles-green-blue-wood.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:40.730Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11513" }, "11514": { "id": 11514, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 381956 }, "keywords": [], "label": "tiki-theme-golf-cart-grass-skirt-portland-swap-meet", "type": "image", "content": "tiki-theme-golf-cart-grass-skirt-portland-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:41.802Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11514" }, "11515": { "id": 11515, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 496445 }, "keywords": [], "label": "tent-with-signs-and-toys-flea-market-portland", "type": "image", "content": "tent-with-signs-and-toys-flea-market-portland.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:42.900Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11515" }, "11516": { "id": 11516, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 580533 }, "keywords": [], "label": "studebaker-front-clip-for-slae-chrome-green-red", "type": "image", "content": "studebaker-front-clip-for-slae-chrome-green-red.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:44.317Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11516" }, "11517": { "id": 11517, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 378509 }, "keywords": [], "label": "stack-of-turquoise-car-doors-on-lawn-with-daisy", "type": "image", "content": "stack-of-turquoise-car-doors-on-lawn-with-daisy.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:45.738Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11517" }, "11518": { "id": 11518, "size": { "content": { "width": 421, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 165642 }, "keywords": [], "label": "stack-of-license-plates-from-usa", "type": "image", "content": "stack-of-license-plates-from-usa.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:46.521Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11518" }, "11519": { "id": 11519, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 384707 }, "keywords": [], "label": "rusty-vintage-truck-blue-sky-trees", "type": "image", "content": "rusty-vintage-truck-blue-sky-trees.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:47.804Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11519" }, "11520": { "id": 11520, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 274547 }, "keywords": [], "label": "red-sedan-white-roof-blanket-back-seat", "type": "image", "content": "red-sedan-white-roof-blanket-back-seat.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:48.601Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11520" }, "11521": { "id": 11521, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 342619 }, "keywords": [], "label": "red-manifold-blue-shop-wipes-flea-market", "type": "image", "content": "red-manifold-blue-shop-wipes-flea-market.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:49.808Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11521" }, "11522": { "id": 11522, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 323255 }, "keywords": [], "label": "pile-of-parts-cardboard-box-green-red-grey", "type": "image", "content": "pile-of-parts-cardboard-box-green-red-grey.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:50.726Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11522" }, "11523": { "id": 11523, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 592430 }, "keywords": [], "label": "pile-of-junk-trim-rings-headlights-flea-market", "type": "image", "content": "pile-of-junk-trim-rings-headlights-flea-market.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:52.684Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11523" }, "11524": { "id": 11524, "size": { "content": { "width": 1860, "height": 687 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 350611 }, "keywords": [], "label": "overview-portland-swap-meet-2026", "type": "image", "content": "overview-portland-swap-meet-2026.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:53.775Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11524" }, "11525": { "id": 11525, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 377619 }, "keywords": [], "label": "old-steering-wheels-crusty-waorn-portland", "type": "image", "content": "old-steering-wheels-crusty-waorn-portland.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:54.867Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11525" }, "11526": { "id": 11526, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 469084 }, "keywords": [], "label": "oil-cans-red-yellow-blue-display-portland-swap-meet", "type": "image", "content": "oil-cans-red-yellow-blue-display-portland-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:56.336Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11526" }, "11527": { "id": 11527, "size": { "content": { "width": 912, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 345108 }, "keywords": [], "label": "metal-arrow-sign-flea-market", "type": "image", "content": "metal-arrow-sign-flea-market.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:57.566Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11527" }, "11528": { "id": 11528, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 424205 }, "keywords": [], "label": "men-talking-golf-cart-parts-wanted-portland-sweap-meet", "type": "image", "content": "men-talking-golf-cart-parts-wanted-portland-sweap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:26:59.094Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11528" }, "11529": { "id": 11529, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 284999 }, "keywords": [], "label": "mannequin-in-hot-rod-boat-PIR", "type": "image", "content": "mannequin-in-hot-rod-boat-PIR.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:00.132Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11529" }, "11530": { "id": 11530, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 601144 }, "keywords": [], "label": "honda-90-motorcycle-yellow-portland-swap-meet", "type": "image", "content": "honda-90-motorcycle-yellow-portland-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:01.447Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11530" }, "11531": { "id": 11531, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 424659 }, "keywords": [], "label": "harley-davidson-white-golf-cart-for-sale-portland-swap-meet", "type": "image", "content": "harley-davidson-white-golf-cart-for-sale-portland-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:03.281Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11531" }, "11532": { "id": 11532, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 228576 }, "keywords": [], "label": "green-vintage-panel-van-ford", "type": "image", "content": "green-vintage-panel-van-ford.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:04.286Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11532" }, "11533": { "id": 11533, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 323119 }, "keywords": [], "label": "geo-tracker-custom-4x4-portland-swap-meet", "type": "image", "content": "geo-tracker-custom-4x4-portland-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:05.546Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11533" }, "11534": { "id": 11534, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 635484 }, "keywords": [], "label": "door-card-and-tailpipe-sculpture-art", "type": "image", "content": "door-card-and-tailpipe-sculpture-art.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:06.978Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11534" }, "11535": { "id": 11535, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 304782 }, "keywords": [], "label": "chevy20-truck-fender-for-sale", "type": "image", "content": "chevy20-truck-fender-for-sale.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:08.152Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11535" }, "11536": { "id": 11536, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 331033 }, "keywords": [], "label": "chevy-cheyenne-fender-orange-whitw-creamsicle", "type": "image", "content": "chevy-cheyenne-fender-orange-whitw-creamsicle.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:09.312Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11536" }, "11537": { "id": 11537, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 428114 }, "keywords": [], "label": "car-logos-parts-tellow-red-blue-fle-market", "type": "image", "content": "car-logos-parts-tellow-red-blue-fle-market.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:10.494Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11537" }, "11538": { "id": 11538, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 683671 }, "keywords": [], "label": "car-logos-for-sale-swap-meet", "type": "image", "content": "car-logos-for-sale-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:11.864Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11538" }, "11539": { "id": 11539, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 538357 }, "keywords": [], "label": "camshaft-49-ford-in-gravel", "type": "image", "content": "camshaft-49-ford-in-gravel.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:13.300Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11539" }, "11540": { "id": 11540, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 524510 }, "keywords": [], "label": "brass-gold-objects-on-dark-paevment-stop-sign", "type": "image", "content": "brass-gold-objects-on-dark-paevment-stop-sign.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:14.796Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11540" }, "11541": { "id": 11541, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 283226 }, "keywords": [], "label": "bearded-santa-claus-look-alike-with-snata-claus-statue-portland", "type": "image", "content": "bearded-santa-claus-look-alike-with-snata-claus-statue-portland.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:16.568Z", "caption": "", "featuredImage": "", "overrides": { "thumbScaleFactor": true }, "filters": [], "key": "11541", "searchable": true }, "11542": { "id": 11542, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 293722 }, "keywords": [], "label": "axes-knives-green-background-flea-marke-", "type": "image", "content": "axes-knives-green-background-flea-marke-.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:17.922Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11542" }, "11543": { "id": 11543, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 408799 }, "keywords": [], "label": "antique-signs-leaned-agaisnt-truck-flea-market-portland", "type": "image", "content": "antique-signs-leaned-agaisnt-truck-flea-market-portland.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:19.886Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11543" }, "11544": { "id": 11544, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 519123 }, "keywords": [], "label": "man-on-bike-towing-stack-of-tires", "type": "image", "content": "man-on-bike-towing-stack-of-tires.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:27:21.530Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11544" }, "11545": { "id": 11545, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 159789 }, "keywords": [], "label": "abandonned-modular-home-double-wide-salton-sea-california", "type": "image", "content": "abandonned-modular-home-double-wide-salton-sea-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:36.155Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11545", "postDate": "2026-04-24T15:27:07.259Z" }, "11546": { "id": 11546, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 208857 }, "keywords": [], "label": "abandonned-roadside-market-builing-stone-wood-red-joshua-tree", "type": "image", "content": "abandonned-roadside-market-builing-stone-wood-red-joshua-tree.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:38.931Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11546", "postDate": "2026-04-24T15:27:07.259Z" }, "11547": { "id": 11547, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 256299 }, "keywords": [], "label": "abandonned-vintage-motor-boat-behind-chainlink-fence-bombay-beach-salton-sea", "type": "image", "content": "abandonned-vintage-motor-boat-behind-chainlink-fence-bombay-beach-salton-sea.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:40.982Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11547", "postDate": "2026-04-24T15:27:07.259Z" }, "11548": { "id": 11548, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 148103 }, "keywords": [], "label": "aframe-church-with-snowy-mountains-independence-CA", "type": "image", "content": "aframe-church-with-snowy-mountains-independence-CA.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:43.064Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11548", "postDate": "2026-04-24T15:27:07.259Z" }, "11549": { "id": 11549, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 158409 }, "keywords": [], "label": "aframe-cocktails-dancing-a-bar-island-lakes-idaho-", "type": "image", "content": "aframe-cocktails-dancing-a-bar-island-lakes-idaho-.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:45.245Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11549", "postDate": "2026-04-24T15:27:07.259Z" }, "11550": { "id": 11550, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 198654 }, "keywords": [], "label": "aframe-shasta-lodge-motel-redding-california", "type": "image", "content": "aframe-shasta-lodge-motel-redding-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:47.428Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11550", "postDate": "2026-04-24T15:27:07.259Z" }, "11551": { "id": 11551, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 253353 }, "keywords": [], "label": "black-snag-rolling-hills-sunrise-diamond-craters", "type": "image", "content": "black-snag-rolling-hills-sunrise-diamond-craters.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:49.699Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11551", "postDate": "2026-04-24T15:27:07.259Z" }, "11552": { "id": 11552, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 173782 }, "keywords": [], "label": "blue-stucoo-wall-window-tan-verticalmblinds-glass-jars-tularosa-NM", "type": "image", "content": "blue-stucoo-wall-window-tan-verticalmblinds-glass-jars-tularosa-NM.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:52.060Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11552", "postDate": "2026-04-24T15:27:07.259Z" }, "11553": { "id": 11553, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 289659 }, "keywords": [], "label": "boulder-garden-gods-love-way-mojave-desert", "type": "image", "content": "boulder-garden-gods-love-way-mojave-desert.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:54.524Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11553", "postDate": "2026-04-24T15:27:07.259Z" }, "11554": { "id": 11554, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 339348 }, "keywords": [], "label": "bristle-cone-pine-wood-detail-great-basin-NP", "type": "image", "content": "bristle-cone-pine-wood-detail-great-basin-NP.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:44:57.268Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11554", "postDate": "2026-04-24T15:27:07.259Z" }, "11555": { "id": 11555, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 343739 }, "keywords": [], "label": "bristlecone-pine-wood-detail-california", "type": "image", "content": "bristlecone-pine-wood-detail-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:00.019Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11555", "postDate": "2026-04-24T15:27:07.259Z" }, "11556": { "id": 11556, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 323385 }, "keywords": [], "label": "brittle-rock-crust-edmaiers-secret-utah", "type": "image", "content": "brittle-rock-crust-edmaiers-secret-utah.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:02.978Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11556", "postDate": "2026-04-24T15:27:07.259Z" }, "11557": { "id": 11557, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 142597 }, "keywords": [], "label": "cabin-mojave-desert-gamma-gulch-historic-photo", "type": "image", "content": "cabin-mojave-desert-gamma-gulch-historic-photo.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:05.761Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11557", "postDate": "2026-04-24T15:27:07.259Z" }, "11558": { "id": 11558, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 261152 }, "keywords": [], "label": "classic-alluvial-fan-zabriske-point-death-valley", "type": "image", "content": "classic-alluvial-fan-zabriske-point-death-valley.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:09.132Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11558", "postDate": "2026-04-24T15:27:07.259Z" }, "11559": { "id": 11559, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 236801 }, "keywords": [], "label": "cloudy-sunset-snow-cap-mountains-sun-break-blue-great-orange", "type": "image", "content": "cloudy-sunset-snow-cap-mountains-sun-break-blue-great-orange.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:12.342Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11559", "postDate": "2026-04-24T15:27:07.259Z" }, "11560": { "id": 11560, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 184528 }, "keywords": [], "label": "colorful-cement-block-wall-bug-out-vehicle-lucerne-valley-ca", "type": "image", "content": "colorful-cement-block-wall-bug-out-vehicle-lucerne-valley-ca.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:15.732Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11560", "postDate": "2026-04-24T15:27:07.259Z" }, "11561": { "id": 11561, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 176526 }, "keywords": [], "label": "colorful-roadside-motel-big-rock-candy-mountain-utah", "type": "image", "content": "colorful-roadside-motel-big-rock-candy-mountain-utah.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:19.371Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11561", "postDate": "2026-04-24T15:27:07.259Z" }, "11562": { "id": 11562, "size": { "content": { "width": 1425, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 262957 }, "keywords": [], "label": "cowboys-riding-at-sunset-grand-teton-NP", "type": "image", "content": "cowboys-riding-at-sunset-grand-teton-NP.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:22.878Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11562", "postDate": "2026-04-24T15:27:07.259Z" }, "11563": { "id": 11563, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 140111 }, "keywords": [], "label": "crucifix-skull-rosary-blue-sky-eyeball-close-up", "type": "image", "content": "crucifix-skull-rosary-blue-sky-eyeball-close-up.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:26.987Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11563", "postDate": "2026-04-24T15:27:07.259Z" }, "11564": { "id": 11564, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 276298 }, "keywords": [], "label": "dead-cactus-brown-wilted-arizona", "type": "image", "content": "dead-cactus-brown-wilted-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:30.703Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11564", "postDate": "2026-04-24T15:27:07.259Z" }, "11565": { "id": 11565, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 355557 }, "keywords": [], "label": "death-valley-alluvial-fan-zabriske-point", "type": "image", "content": "death-valley-alluvial-fan-zabriske-point.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:34.528Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11565", "postDate": "2026-04-24T15:27:07.259Z" }, "11566": { "id": 11566, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 56821 }, "keywords": [], "label": "desert-lights-night-orange-purple-white-red", "type": "image", "content": "desert-lights-night-orange-purple-white-red.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:38.651Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11566", "postDate": "2026-04-24T15:27:07.259Z" }, "11567": { "id": 11567, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181967 }, "keywords": [], "label": "diamond-sahped-motel-red-lodge-montana", "type": "image", "content": "diamond-sahped-motel-red-lodge-montana.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:42.943Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11567", "postDate": "2026-04-24T15:27:07.259Z" }, "11568": { "id": 11568, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 60796 }, "keywords": [], "label": "donut-shaped-cloud-in-blue-sky-mojave-desert-california", "type": "image", "content": "donut-shaped-cloud-in-blue-sky-mojave-desert-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:47.311Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11568", "postDate": "2026-04-24T15:27:07.259Z" }, "11569": { "id": 11569, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 131818 }, "keywords": [], "label": "dust-desert-floor-motorcycle-raching-sunset", "type": "image", "content": "dust-desert-floor-motorcycle-raching-sunset.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:51.457Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11569", "postDate": "2026-04-24T15:27:07.259Z" }, "11570": { "id": 11570, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 111452 }, "keywords": [], "label": "dust-devil-on-desert-floor-at-sunset-oregon", "type": "image", "content": "dust-devil-on-desert-floor-at-sunset-oregon.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:45:56.244Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11570", "postDate": "2026-04-24T15:27:07.259Z" }, "11571": { "id": 11571, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 171187 }, "keywords": [], "label": "elmer-jos-our-bar-abandonned-cars-marysville-utah", "type": "image", "content": "elmer-jos-our-bar-abandonned-cars-marysville-utah.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:06.231Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11571", "postDate": "2026-04-24T15:27:07.259Z" }, "11572": { "id": 11572, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 253238 }, "keywords": [], "label": "fieldstone-building-facade-tan-teal-666-california", "type": "image", "content": "fieldstone-building-facade-tan-teal-666-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:11.685Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11572", "postDate": "2026-04-24T15:27:07.259Z" }, "11573": { "id": 11573, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 233393 }, "keywords": [], "label": "fieworks-starburst-black-sky", "type": "image", "content": "fieworks-starburst-black-sky.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:17.369Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11573", "postDate": "2026-04-24T15:27:07.259Z" }, "11574": { "id": 11574, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 130029 }, "keywords": [], "label": "full-moon-rise-alvaord-desert-summer", "type": "image", "content": "full-moon-rise-alvaord-desert-summer.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:23.515Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11574", "postDate": "2026-04-24T15:27:07.259Z" }, "11575": { "id": 11575, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 332985 }, "keywords": [], "label": "gas-cans-cement-block-wall-joshua-tree-californa", "type": "image", "content": "gas-cans-cement-block-wall-joshua-tree-californa.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:29.551Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11575", "postDate": "2026-04-24T15:27:07.259Z" }, "11576": { "id": 11576, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 153091 }, "keywords": [], "label": "giant-rock-largest-freestanding-boulder-landers-california", "type": "image", "content": "giant-rock-largest-freestanding-boulder-landers-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:35.442Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11576", "postDate": "2026-04-24T15:27:07.259Z" }, "11577": { "id": 11577, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 292745 }, "keywords": [], "label": "glassy-hot-springs-pool-mammoth-yellowstone-montana", "type": "image", "content": "glassy-hot-springs-pool-mammoth-yellowstone-montana.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:42.040Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11577", "postDate": "2026-04-24T15:27:07.259Z" }, "11578": { "id": 11578, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 227696 }, "keywords": [], "label": "glow-of-the-sun-between-sandstone-rocks", "type": "image", "content": "glow-of-the-sun-between-sandstone-rocks.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:48.831Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11578", "postDate": "2026-04-24T15:27:07.259Z" }, "11579": { "id": 11579, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 183042 }, "keywords": [], "label": "grain-silo-moody-cloudy-sky-tulelake-california", "type": "image", "content": "grain-silo-moody-cloudy-sky-tulelake-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:46:56.061Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11579", "postDate": "2026-04-24T15:27:07.259Z" }, "11580": { "id": 11580, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 136268 }, "keywords": [], "label": "great-salt-lke-from-airplane-window-pink-green-blue", "type": "image", "content": "great-salt-lke-from-airplane-window-pink-green-blue.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:03.532Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11580", "postDate": "2026-04-24T15:27:07.259Z" }, "11581": { "id": 11581, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 97953 }, "keywords": [], "label": "green-lake-waters-berkeley-pit-mine-butte-montana", "type": "image", "content": "green-lake-waters-berkeley-pit-mine-butte-montana.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:11.265Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11581", "postDate": "2026-04-24T15:27:07.259Z" }, "11582": { "id": 11582, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 101340 }, "keywords": [], "label": "historic-handball-court-detail-jordan-valley-oregon", "type": "image", "content": "historic-handball-court-detail-jordan-valley-oregon.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:19.508Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11582", "postDate": "2026-04-24T15:27:07.259Z" }, "11583": { "id": 11583, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 91136 }, "keywords": [], "label": "hot-springs-at-sunrise-steam-blue-sky-idaho", "type": "image", "content": "hot-springs-at-sunrise-steam-blue-sky-idaho.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:28.043Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11583", "postDate": "2026-04-24T15:27:07.259Z" }, "11584": { "id": 11584, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 210902 }, "keywords": [], "label": "interesecting-rail-lines-V-shape-from-airplane-window-desert-oregon", "type": "image", "content": "interesecting-rail-lines-V-shape-from-airplane-window-desert-oregon.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:36.787Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11584", "postDate": "2026-04-24T15:27:07.259Z" }, "11585": { "id": 11585, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 136379 }, "keywords": [], "label": "ivanpah-generating-station-mojave-desert-american-power", "type": "image", "content": "ivanpah-generating-station-mojave-desert-american-power.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:46.238Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11585", "postDate": "2026-04-24T15:27:07.259Z" }, "11586": { "id": 11586, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 132634 }, "keywords": [], "label": "jagged-white-rock-againt-blue-sky-arizona", "type": "image", "content": "jagged-white-rock-againt-blue-sky-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:47:55.793Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11586", "postDate": "2026-04-24T15:27:07.259Z" }, "11587": { "id": 11587, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 184011 }, "keywords": [], "label": "joshua-tree-held-up-by-support-sunny-blue-sky", "type": "image", "content": "joshua-tree-held-up-by-support-sunny-blue-sky.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:48:06.505Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11587", "postDate": "2026-04-24T15:27:07.259Z" }, "11588": { "id": 11588, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 356682 }, "keywords": [], "label": "mammoth-hot-springs-yellowtone-wyoming", "type": "image", "content": "mammoth-hot-springs-yellowtone-wyoming.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:48:17.571Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11588", "postDate": "2026-04-24T15:27:07.259Z" }, "11589": { "id": 11589, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 219685 }, "keywords": [], "label": "mine-tailing-piles-rural-nevada-ely", "type": "image", "content": "mine-tailing-piles-rural-nevada-ely.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:48:29.053Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11589", "postDate": "2026-04-24T15:27:07.259Z" }, "11590": { "id": 11590, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 106321 }, "keywords": [], "label": "mission-bell-blue-sky-sunrise-barstow-california", "type": "image", "content": "mission-bell-blue-sky-sunrise-barstow-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:48:40.874Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11590", "postDate": "2026-04-24T15:27:07.259Z" }, "11591": { "id": 11591, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 78218 }, "keywords": [], "label": "modern-thrift-store-tree-painting-couch-brown-wall-bozeman", "type": "image", "content": "modern-thrift-store-tree-painting-couch-brown-wall-bozeman.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:48:53.394Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11591", "postDate": "2026-04-24T15:27:07.259Z" }, "11592": { "id": 11592, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 257698 }, "keywords": [], "label": "nuclear-reactor-Idaho-national-lab-arco-idaho", "type": "image", "content": "nuclear-reactor-Idaho-national-lab-arco-idaho.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:49:06.291Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11592", "postDate": "2026-04-24T15:27:07.259Z" }, "11593": { "id": 11593, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 227558 }, "keywords": [], "label": "ocotillio-bloom-organ-pipes-national-monument-USA", "type": "image", "content": "ocotillio-bloom-organ-pipes-national-monument-USA.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:49:21.197Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11593", "postDate": "2026-04-24T15:27:07.259Z" }, "11594": { "id": 11594, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 249589 }, "keywords": [], "label": "octogon-house-steeple-swirl-sandstone", "type": "image", "content": "octogon-house-steeple-swirl-sandstone.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:49:36.976Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11594", "postDate": "2026-04-24T15:27:07.259Z" }, "11595": { "id": 11595, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 336460 }, "keywords": [], "label": "orange-red-swirled-sand-stone-arizona", "type": "image", "content": "orange-red-swirled-sand-stone-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:49:54.398Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11595", "postDate": "2026-04-24T15:27:07.259Z" }, "11596": { "id": 11596, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 236952 }, "keywords": [], "label": "organ-pipe-cactus-desrt-blue-sky-summer-arizona", "type": "image", "content": "organ-pipe-cactus-desrt-blue-sky-summer-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:50:14.068Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11596", "postDate": "2026-04-24T15:27:07.259Z" }, "11597": { "id": 11597, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 108088 }, "keywords": [], "label": "painting-with-crucifix-mission-lompoc-california", "type": "image", "content": "painting-with-crucifix-mission-lompoc-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:50:33.561Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11597", "postDate": "2026-04-24T15:27:07.259Z" }, "11598": { "id": 11598, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 121924 }, "keywords": [], "label": "palms-in-vintage-motel-gila-bend-arizona", "type": "image", "content": "palms-in-vintage-motel-gila-bend-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:50:55.183Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11598", "postDate": "2026-04-24T15:27:07.259Z" }, "11599": { "id": 11599, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 226962 }, "keywords": [], "label": "pfieffer-beach-keyhole-arch-sun-spot-big-sur", "type": "image", "content": "pfieffer-beach-keyhole-arch-sun-spot-big-sur.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:51:18.398Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11599", "postDate": "2026-04-24T15:27:07.259Z" }, "11600": { "id": 11600, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 128439 }, "keywords": [], "label": "phone-booth-with-snowy-mountains-lucerne-valley-california", "type": "image", "content": "phone-booth-with-snowy-mountains-lucerne-valley-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:51:45.057Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11600", "postDate": "2026-04-24T15:27:07.259Z" }, "11601": { "id": 11601, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 485793 }, "keywords": [], "label": "pile-of-broken-sticks-tangled-grey-lake-tahoe", "type": "image", "content": "pile-of-broken-sticks-tangled-grey-lake-tahoe.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:52:10.779Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11601", "postDate": "2026-04-24T15:27:07.259Z" }, "11602": { "id": 11602, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 421399 }, "keywords": [], "label": "pine-cones-sun-blue-sky-whitney-portal-eastern-sierra", "type": "image", "content": "pine-cones-sun-blue-sky-whitney-portal-eastern-sierra.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:52:41.942Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11602", "postDate": "2026-04-24T15:27:07.259Z" }, "11603": { "id": 11603, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 247121 }, "keywords": [], "label": "pink-sand-dune-sunrise-coral-dunes-utah", "type": "image", "content": "pink-sand-dune-sunrise-coral-dunes-utah.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:53:13.125Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11603", "postDate": "2026-04-24T15:27:07.259Z" }, "11604": { "id": 11604, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 236880 }, "keywords": [], "label": "pray-and-obey-colarado-city-arizona-hildale-utah-rulon-jeffs", "type": "image", "content": "pray-and-obey-colarado-city-arizona-hildale-utah-rulon-jeffs.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:53:40.983Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11604", "postDate": "2026-04-24T15:27:07.259Z" }, "11605": { "id": 11605, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 104246 }, "keywords": [], "label": "pyramid-history-of-the-world-in-granite", "type": "image", "content": "pyramid-history-of-the-world-in-granite.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:54:11.092Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11605", "postDate": "2026-04-24T15:27:07.259Z" }, "11606": { "id": 11606, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 88771 }, "keywords": [], "label": "restomod-checvy-suburban-beater-oregon-desert", "type": "image", "content": "restomod-checvy-suburban-beater-oregon-desert.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:54:42.161Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11606", "postDate": "2026-04-24T15:27:07.259Z" }, "11607": { "id": 11607, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 252525 }, "keywords": [], "label": "right-angle-erosion-park-avenue-wash-arches-national-park", "type": "image", "content": "right-angle-erosion-park-avenue-wash-arches-national-park.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:55:11.866Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11607", "postDate": "2026-04-24T15:27:07.259Z" }, "11608": { "id": 11608, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 159509 }, "keywords": [], "label": "riviera-keys-sunrise-plam-tree-salton-sea-california", "type": "image", "content": "riviera-keys-sunrise-plam-tree-salton-sea-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:55:45.256Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11608", "postDate": "2026-04-24T15:27:07.259Z" }, "11609": { "id": 11609, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 252742 }, "keywords": [], "label": "road-hillside-death-valley-california", "type": "image", "content": "road-hillside-death-valley-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:56:21.799Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11609", "postDate": "2026-04-24T15:27:07.259Z" }, "11610": { "id": 11610, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 126437 }, "keywords": [], "label": "roadisde-resturant-overgrown-headge-cloudy-sky", "type": "image", "content": "roadisde-resturant-overgrown-headge-cloudy-sky.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:56:56.564Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11610", "postDate": "2026-04-24T15:27:07.259Z" }, "11611": { "id": 11611, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 49242 }, "keywords": [], "label": "rocket-launch-at-dusk-white-sands-new-mexico", "type": "image", "content": "rocket-launch-at-dusk-white-sands-new-mexico.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:57:34.768Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11611", "postDate": "2026-04-24T15:27:07.259Z" }, "11612": { "id": 11612, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 237088 }, "keywords": [], "label": "sagurao-cactus-organ-pipes-national-mounment-arizona", "type": "image", "content": "sagurao-cactus-organ-pipes-national-mounment-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:58:15.761Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11612", "postDate": "2026-04-24T15:27:07.259Z" }, "11613": { "id": 11613, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 158607 }, "keywords": [], "label": "sahara-motel-sign-jordan-valley-oregon", "type": "image", "content": "sahara-motel-sign-jordan-valley-oregon.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:58:56.839Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11613", "postDate": "2026-04-24T15:27:07.259Z" }, "11614": { "id": 11614, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 63696 }, "keywords": [], "label": "speeding-motorcycle-dust-storm-sunset-oregon-desert-mountains", "type": "image", "content": "speeding-motorcycle-dust-storm-sunset-oregon-desert-mountains.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T00:59:39.530Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11614", "postDate": "2026-04-24T15:27:07.259Z" }, "11615": { "id": 11615, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 196528 }, "keywords": [], "label": "stormy-sunset-glen-canyon-NRA-USA", "type": "image", "content": "stormy-sunset-glen-canyon-NRA-USA.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:00:34.083Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11615", "postDate": "2026-04-24T15:27:07.259Z" }, "11616": { "id": 11616, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 158390 }, "keywords": [], "label": "stucco-house-zion-colorado-city-hildale-utah-arizona", "type": "image", "content": "stucco-house-zion-colorado-city-hildale-utah-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:01:21.322Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11616", "postDate": "2026-04-24T15:27:07.259Z" }, "11617": { "id": 11617, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 123266 }, "keywords": [], "label": "stucco-store-front-in-afternoon-sun-orange-blue-sky", "type": "image", "content": "stucco-store-front-in-afternoon-sun-orange-blue-sky.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:02:11.343Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11617", "postDate": "2026-04-24T15:27:07.259Z" }, "11618": { "id": 11618, "size": { "content": { "width": 1748, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 184779 }, "keywords": [], "label": "sunrise-monument-valley-arizona", "type": "image", "content": "sunrise-monument-valley-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:03:02.945Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11618", "postDate": "2026-04-24T15:27:07.259Z" }, "11619": { "id": 11619, "size": { "content": { "width": 1748, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 166124 }, "keywords": [], "label": "sunset-after-haboob-alvord-desrt-red-sky-clouds-moody", "type": "image", "content": "sunset-after-haboob-alvord-desrt-red-sky-clouds-moody.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:03:58.932Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11619", "postDate": "2026-04-24T15:27:07.259Z" }, "11620": { "id": 11620, "size": { "content": { "width": 1748, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 201655 }, "keywords": [], "label": "sunset-vintage-roadside-motel-idaho", "type": "image", "content": "sunset-vintage-roadside-motel-idaho.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:04:54.629Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11620", "postDate": "2026-04-24T15:27:07.259Z" }, "11621": { "id": 11621, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 334359 }, "keywords": [], "label": "tangled-string-freeway-view-fomr-the-air", "type": "image", "content": "tangled-string-freeway-view-fomr-the-air.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:05:55.305Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11621", "postDate": "2026-04-24T15:27:07.259Z" }, "11622": { "id": 11622, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 91932 }, "keywords": [], "label": "the-integratron-white-dome-soundbath-landers-california-mojave-desert", "type": "image", "content": "the-integratron-white-dome-soundbath-landers-california-mojave-desert.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:06:58.568Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11622", "postDate": "2026-04-24T15:27:07.259Z" }, "11623": { "id": 11623, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 125748 }, "keywords": [], "label": "thermal-vents-summer-blue-sky-mickey-hotspringsoregon", "type": "image", "content": "thermal-vents-summer-blue-sky-mickey-hotspringsoregon.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:08:04.328Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11623", "postDate": "2026-04-24T15:27:07.259Z" }, "11624": { "id": 11624, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 457481 }, "keywords": [], "label": "tumbleweed-in-sunset-dark-background", "type": "image", "content": "tumbleweed-in-sunset-dark-background.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:09:13.073Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11624", "postDate": "2026-04-24T15:27:07.259Z" }, "11625": { "id": 11625, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 144340 }, "keywords": [], "label": "vintage-aluminum-trailer-rock-pile-mojave-desert", "type": "image", "content": "vintage-aluminum-trailer-rock-pile-mojave-desert.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:10:25.478Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11625", "postDate": "2026-04-24T15:27:07.259Z" }, "11626": { "id": 11626, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 104275 }, "keywords": [], "label": "vintage-brown-white-RV-summer-lake-powell-arizona", "type": "image", "content": "vintage-brown-white-RV-summer-lake-powell-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:11:41.552Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11626", "postDate": "2026-04-24T15:27:07.259Z" }, "11627": { "id": 11627, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 104436 }, "keywords": [], "label": "vintage-doll-heads-in-glass-case-montana", "type": "image", "content": "vintage-doll-heads-in-glass-case-montana.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:13:00.796Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11627", "postDate": "2026-04-24T15:27:07.259Z" }, "11628": { "id": 11628, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 164127 }, "keywords": [], "label": "vintage-rest-area-shade-structure-california", "type": "image", "content": "vintage-rest-area-shade-structure-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:14:20.828Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11628", "postDate": "2026-04-24T15:27:07.259Z" }, "11629": { "id": 11629, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 121522 }, "keywords": [], "label": "vintage-rest-area-shade-structure-shasta-california", "type": "image", "content": "vintage-rest-area-shade-structure-shasta-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:15:45.124Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11629", "postDate": "2026-04-24T15:27:07.259Z" }, "11630": { "id": 11630, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 181261 }, "keywords": [], "label": "vintage-trailer-steel-fence-orange-joshua-trees-blue-sky-green-mojave-desert", "type": "image", "content": "vintage-trailer-steel-fence-orange-joshua-trees-blue-sky-green-mojave-desert.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:17:14.102Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11630", "postDate": "2026-04-24T15:27:07.259Z" }, "11631": { "id": 11631, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 119590 }, "keywords": [], "label": "vintage-truck-camper-detail-brown-white", "type": "image", "content": "vintage-truck-camper-detail-brown-white.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:18:58.998Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11631", "postDate": "2026-04-24T15:27:07.259Z" }, "11632": { "id": 11632, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 213798 }, "keywords": [], "label": "virgin-mary-statue-shine-marfa-texas-night", "type": "image", "content": "virgin-mary-statue-shine-marfa-texas-night.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:21:11.921Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11632", "postDate": "2026-04-24T15:27:07.259Z" }, "11633": { "id": 11633, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 204017 }, "keywords": [], "label": "white-abandonned-house-wrapped-in-blue-string-new-mexico", "type": "image", "content": "white-abandonned-house-wrapped-in-blue-string-new-mexico.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:22:55.789Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11633", "postDate": "2026-04-24T15:27:07.259Z" }, "11634": { "id": 11634, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 329274 }, "keywords": [], "label": "white-church-palm-trees-blue-sky-ajo-arizona", "type": "image", "content": "white-church-palm-trees-blue-sky-ajo-arizona.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:24:39.142Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11634", "postDate": "2026-04-24T15:27:07.259Z" }, "11635": { "id": 11635, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 217409 }, "keywords": [], "label": "white-rock-cone-dark-red-background-blue-sky-death-valley", "type": "image", "content": "white-rock-cone-dark-red-background-blue-sky-death-valley.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:26:27.806Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11635", "postDate": "2026-04-24T15:27:07.259Z" }, "11636": { "id": 11636, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 208579 }, "keywords": [], "label": "white-sand-bottom-of-black-volcanic-crater-amboy-crater-mojave-desert", "type": "image", "content": "white-sand-bottom-of-black-volcanic-crater-amboy-crater-mojave-desert.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:29:08.378Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11636", "postDate": "2026-04-24T15:27:07.259Z" }, "11637": { "id": 11637, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 436677 }, "keywords": [], "label": "wood-panel-covering-window-wood-grain-red-siding", "type": "image", "content": "wood-panel-covering-window-wood-grain-red-siding.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:31:08.432Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11637", "postDate": "2026-04-24T15:27:07.259Z" }, "11638": { "id": 11638, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 116902 }, "keywords": [], "label": "young-brown-colt-staring-through-fence", "type": "image", "content": "young-brown-colt-staring-through-fence.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:33:10.676Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11638", "postDate": "2026-04-24T15:27:07.259Z" }, "11639": { "id": 11639, "size": { "content": { "width": 874, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 156839 }, "keywords": [], "label": "ziggurat-building-pyramid-sacramento-california", "type": "image", "content": "ziggurat-building-pyramid-sacramento-california.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T01:35:15.763Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "postDate": "2026-04-24T15:27:07.259Z", "key": "11639" }, "11640": { "id": 11640, "size": { "content": { "width": 1520, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 741495 }, "keywords": [], "label": "random-parts-brown-tarp-portland-swap-meet", "type": "image", "content": "random-parts-brown-tarp-portland-swap-meet.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-04-24T16:18:13.007Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [] }, "11641": { "id": 11641, "size": { "content": { "width": 1630, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 193942 }, "keywords": [], "label": "TEVA-SS26-AVENTRAIL-0173-copy", "type": "image", "content": "TEVA-SS26-AVENTRAIL-0173-copy.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:30.966Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11641" }, "11642": { "id": 11642, "size": { "content": { "width": 1860, "height": 426 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 44190 }, "keywords": [], "label": "RIO-LANDSCAPE", "type": "image", "content": "RIO-LANDSCAPE.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:31.958Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11642" }, "11643": { "id": 11643, "size": { "content": { "width": 1860, "height": 426 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 39522 }, "keywords": [], "label": "RIO-LANDSCAPE-fianl", "type": "image", "content": "RIO-LANDSCAPE-fianl.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:32.876Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11643" }, "11644": { "id": 11644, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 55944 }, "keywords": [], "label": "RF_NAMA-C2-SHOT-1-BLACK-BASE-0114", "type": "image", "content": "RF_NAMA-C2-SHOT-1-BLACK-BASE-0114.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:33.664Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11644" }, "11645": { "id": 11645, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 72867 }, "keywords": [], "label": "NAMA-SU23-C2-HERO-B-JUICE-SMOOTH-INGRED-GLASS", "type": "image", "content": "NAMA-SU23-C2-HERO-B-JUICE-SMOOTH-INGRED-GLASS.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:34.323Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11645" }, "11646": { "id": 11646, "size": { "content": { "width": 1841, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 170125 }, "keywords": [], "label": "LOVEDOTCOM-HOMELIVING-final", "type": "image", "content": "LOVEDOTCOM-HOMELIVING-final.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:35.177Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11646" }, "11647": { "id": 11647, "size": { "content": { "width": 1841, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 179896 }, "keywords": [], "label": "LOVEDOTCOM-HOMELIVING-063", "type": "image", "content": "LOVEDOTCOM-HOMELIVING-063.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:36.063Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11647" }, "11648": { "id": 11648, "size": { "content": { "width": 1860, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 274904 }, "keywords": [], "label": "HANDSHAKE-SKETCH_0100", "type": "image", "content": "HANDSHAKE-SKETCH_0100.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:36.860Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11648" }, "11649": { "id": 11649, "size": { "content": { "width": 1860, "height": 1116 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 265142 }, "keywords": [], "label": "HANDSHAKE-SKETCH_0100-final", "type": "image", "content": "HANDSHAKE-SKETCH_0100-final.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:37.644Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11649" }, "11650": { "id": 11650, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 107204 }, "keywords": [], "label": "COPROJ-SARTORI-ITAL-HERB-2-FRONT-0082", "type": "image", "content": "COPROJ-SARTORI-ITAL-HERB-2-FRONT-0082.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:38.706Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11650" }, "11651": { "id": 11651, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 107036 }, "keywords": [], "label": "COPROJ-SARTORI-ITAL-HERB-2-FRONT-0082-final", "type": "image", "content": "COPROJ-SARTORI-ITAL-HERB-2-FRONT-0082-final.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:39.498Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11651" }, "11652": { "id": 11652, "size": { "content": { "width": 1140, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 73523 }, "keywords": [], "label": "Black_Base_SOURCE", "type": "image", "content": "Black_Base_SOURCE.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:40.301Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11652" }, "11653": { "id": 11653, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 90166 }, "keywords": [], "label": "AHNU-SOLE-TECH-STACK", "type": "image", "content": "AHNU-SOLE-TECH-STACK.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:41.220Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11653" }, "11654": { "id": 11654, "size": { "content": { "width": 855, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 57515 }, "keywords": [], "label": "AHNU-SOLE-TECH-STACK-final", "type": "image", "content": "AHNU-SOLE-TECH-STACK-final.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:42.083Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11654" }, "11655": { "id": 11655, "size": { "content": { "width": 1630, "height": 1140 }, "thumb": { "width": 0, "height": 0 }, "featuredImage": { "width": 0, "height": 0 }, "bytes": 207280 }, "keywords": [], "label": "_final", "type": "image", "content": "_final.jpg", "thumb": "", "linkTarget": "", "dateAdded": "2026-05-06T14:52:42.869Z", "caption": "", "featuredImage": "", "overrides": {}, "filters": [], "key": "11655" } }